Mouse HNRPM Monoclonal Antibody | anti-HNRPM antibody

HNRPM (Heterogeneous Nuclear Ribonucleoprotein M, DKFZp547H118, HNRNPM4, HNRPM, HNRPM4, HTGR1, NAGR1) (HRP)

Cat. Num. AAA6181438

• Gene Names: HNRNPM; CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
• Applications: Immunofluorescence, Western Blot
• Purity: Purified
• Synonyms: HNRPM; Monoclonal Antibody; HNRPM (Heterogeneous Nuclear Ribonucleoprotein M; DKFZp547H118; HNRNPM4; HNRPM4; HTGR1; NAGR1) (HRP); Heterogeneous Nuclear Ribonucleoprotein M; NAGR1; anti-HNRPM antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2B6
• Specificity: Recognizes HNRPM.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HNRPM antibody: Immunofluorescence (IF), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HNRPM (NP_005959, 17aa-112aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(HNRPM monoclonal antibody (M01), clone 2B6. Western Blot analysis of HNRPM expression in HepG2 (Cat # L019V1).)

Testing Data

(Detection limit for recombinant GST tagged HNRPM is approximately 1ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNRNPM on HeLa cell. [antibody concentration 10 ug/ml])

Product Categories/Family for anti-HNRPM antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14141152
• NCBI GeneID: 4670
• NCBI Accession #: NP_005959
• NCBI GenBank Nucleotide #: NM_005968
• UniProt Accession #: P52272; Q15584; Q8WZ44; Q96H56; Q9BWL9; Q9Y492
• Molecular Weight: – Da
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein M isoform a
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein M
• NCBI Official Symbol: HNRNPM
• NCBI Official Synonym Symbols: CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein M; CEA receptor; N-acetylglucosamine receptor 1; heterogenous nuclear ribonucleoprotein M4; hnRNA-binding protein M4
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein M
• UniProt Gene Name: HNRNPM
• UniProt Synonym Gene Names: HNRPM; NAGR1; hnRNP M
• UniProt Entry Name: HNRPM_HUMAN

Uniprot Description

hnRNP M: Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Receptor, misc.; RNA splicing; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; extracellular matrix; spliceosome; nuclear matrix; membrane; integral to plasma membrane; nucleolus; paraspeckles

Molecular Function: protein domain specific binding; protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression