Mouse HNRNPM Monoclonal Antibody | anti-HNRNPM antibody

HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M, hnRNP M, HNRPM, NAGR1, DKFZp547H118) (PE)

Cat. Num. AAA6158224

• Gene Names: HNRNPM; CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HNRNPM; Monoclonal Antibody; HNRNPM (Heterogeneous Nuclear Ribonucleoprotein M; hnRNP M; HNRPM; NAGR1; DKFZp547H118) (PE); anti-HNRNPM antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3F7
• Specificity: Recognizes human HNRPM. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-HNRNPM antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa17-112 from human HNRPM (NP_005959) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: KMEEESGAPGVPSGNGAPGPKGEGERPAQNEKRKEKNIKRGGNRFEPYANPTKRYRAFITNIPFDVKWQSLKDLVKEKVGEVTYVELLMDAEGKSR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.3kD).)

Western Blot (WB)

(HNRPM monoclonal antibody Western Blot analysis of HNRPM expression in PC-12.)

Western Blot (WB)

(HNRPM monoclonal antibody Western Blot analysis of HNRPM expression in HepG2.)

Western Blot (WB)

(HNRPM monoclonal antibody. Western Blot analysis of HNRPM expression in NIH/3T3.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HNRPM on formalin-fixed paraffin-embedded human thyroid nodular goiter. [antibody concentration 3ug/ml.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HNRPM on HepG2 cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HNRPM is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-HNRNPM antibody

Antibodies; Nuclear Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 14141152
• NCBI GeneID: 4670
• NCBI Accession #: NP_005959
• NCBI GenBank Nucleotide #: NM_005968
• UniProt Accession #: P52272; Q15584; Q8WZ44; Q96H56; Q9BWL9; Q9Y492
• Molecular Weight: – Da
• NCBI Official Full Name: heterogeneous nuclear ribonucleoprotein M isoform a
• NCBI Official Synonym Full Names: heterogeneous nuclear ribonucleoprotein M
• NCBI Official Symbol: HNRNPM
• NCBI Official Synonym Symbols: CEAR; HNRPM; HTGR1; NAGR1; HNRPM4; HNRNPM4; hnRNP M
• NCBI Protein Information: heterogeneous nuclear ribonucleoprotein M; CEA receptor; N-acetylglucosamine receptor 1; heterogenous nuclear ribonucleoprotein M4; hnRNA-binding protein M4
• UniProt Protein Name: Heterogeneous nuclear ribonucleoprotein M
• Protein Family: Heterogeneous nuclear ribonucleoprotein
• UniProt Gene Name: HNRNPM
• UniProt Synonym Gene Names: HNRPM; NAGR1; hnRNP M
• UniProt Entry Name: HNRPM_HUMAN

Uniprot Description

hnRNP M: Pre-mRNA binding protein in vivo, binds avidly to poly(G) and poly(U) RNA homopolymers in vitro. Involved in splicing. Acts as a receptor for carcinoembryonic antigen in Kupffer cells, may initiate a series of signaling events leading to tyrosine phosphorylation of proteins and induction of IL-1 alpha, IL-6, IL-10 and tumor necrosis factor alpha cytokines. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Nucleolus; Receptor, misc.; RNA splicing; Spliceosome; RNA-binding

Chromosomal Location of Human Ortholog: 19p13.2

Cellular Component: nucleoplasm; extracellular matrix; spliceosome; nuclear matrix; membrane; integral to plasma membrane; nucleolus; paraspeckles

Molecular Function: protein domain specific binding; protein binding; RNA binding; nucleotide binding

Biological Process: alternative nuclear mRNA splicing, via spliceosome; nuclear mRNA splicing, via spliceosome; RNA splicing; gene expression