<
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml])
Mouse HNF4A Monoclonal Antibody | anti-HNF4A antibody
HNF4A (Hepatocyte Nuclear Factor 4, alpha, FLJ39654, HNF4, HNF4a7, HNF4a8, HNF4a9, MODY, MODY1, NR2A1, NR2A21, TCF, TCF14) (Biotin)
Gene Names
HNF4A; TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HNF4A; Monoclonal Antibody; HNF4A (Hepatocyte Nuclear Factor 4; alpha; FLJ39654; HNF4; HNF4a7; HNF4a8; HNF4a9; MODY; MODY1; NR2A1; NR2A21; TCF; TCF14) (Biotin); Hepatocyte Nuclear Factor 4; TCF14; anti-HNF4A antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3C6
Specificity
Recognizes HNF4A.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HNF4A antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HNF4A (NP_000448, 324aa-423aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NDRQYDSRGRFGELLLLLPTLQSITWQMIEQIQFIKLFGMAKIDNLLQEMLLGGSPSDAPHAHHPLHPHLMQEHMGTNVIVANTMPTHLSNGQMCEWPRP
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to HNF4A on HeLa cell. [antibody concentration 10 ug/ml])
Western Blot (WB)
(HNF4A monoclonal antibody (M07), clone 3C6 Western Blot analysis of HNF4A expression in HepG2.)
Western Blot (WB)
(HNF4A monoclonal antibody (M07), clone 3C6 Western Blot analysis of HNF4A expression in HepG2.)
Western Blot (WB)
(HNF4A monoclonal antibody (M07), clone 3C6. Western Blot analysis of HNF4A expression in A-431.)
Western Blot (WB)
(HNF4A monoclonal antibody (M07), clone 3C6. Western Blot analysis of HNF4A expression in A-431.)
Related Product Information for anti-HNF4A antibody
The protein encoded by this gene is a nuclear transcription factor which binds DNA as a homodimer. The encoded protein controls the expression of several genes, including hepatocyte nuclear factor 1 alpha, a transcription factor which regulates the expression of several hepatic genes. This gene may play a role in development of the liver, kidney, and intestines. Mutations in this gene have been associated with monogenic autosomal dominant non-insulin-dependent diabetes mellitus type I. Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq]
Product Categories/Family for anti-HNF4A antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
43,988 Da
NCBI Official Full Name
hepatocyte nuclear factor 4-alpha isoform HNF4alpha2
NCBI Official Synonym Full Names
hepatocyte nuclear factor 4, alpha
NCBI Official Symbol
HNF4A
NCBI Official Synonym Symbols
TCF; HNF4; MODY; FRTS4; MODY1; NR2A1; TCF14; HNF4a7; HNF4a8; HNF4a9; NR2A21; HNF4alpha
NCBI Protein Information
hepatocyte nuclear factor 4-alpha; HNF4alpha10/11/12; TCF-14; hepatic nuclear factor 4 alpha; nuclear receptor subfamily 2 group A member 1; transcription factor 14; transcription factor HNF-4
UniProt Protein Name
Hepatocyte nuclear factor 4-alpha
Protein Family
UniProt Gene Name
HNF4A
UniProt Synonym Gene Names
HNF4; NR2A1; TCF14; HNF-4-alpha; TCF-14
UniProt Entry Name
HNF4A_HUMAN
Similar Products
Product Notes
The HNF4A hnf4a (Catalog #AAA6170951) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HNF4A can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HNF4A hnf4a for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HNF4A, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
