Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell. [antibody concentration 10 ug/ml])

Mouse HMGA2 Monoclonal Antibody | anti-HMGA2 antibody

HMGA2 (High Mobility Group AT-hook 2, BABL, HMGI-C, HMGIC, LIPO, STQTL9) (FITC)

Gene Names
HMGA2; BABL; LIPO; HMGIC; HMGI-C; STQTL9
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HMGA2; Monoclonal Antibody; HMGA2 (High Mobility Group AT-hook 2; BABL; HMGI-C; HMGIC; LIPO; STQTL9) (FITC); High Mobility Group AT-hook 2; STQTL9; anti-HMGA2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D3
Specificity
Recognizes HMGA2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-HMGA2 antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HMGA2 (NP_003474, 1aa-92aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSARGEGAGQPSTSAQGQPAAPAPQKRGRGRPRKQQQEPTGEPSPKRPRGRPKGSKNKSPSKAAQKKAEATGEKRPRGRPRKWPQQVVQKKP
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HMGA2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-HMGA2 antibody
This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq]
Product Categories/Family for anti-HMGA2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
12.8 kDa (117aa)
NCBI Official Full Name
high mobility group protein HMGI-C isoform a
NCBI Official Synonym Full Names
high mobility group AT-hook 2
NCBI Official Symbol
HMGA2
NCBI Official Synonym Symbols
BABL; LIPO; HMGIC; HMGI-C; STQTL9
NCBI Protein Information
high mobility group protein HMGI-C
UniProt Protein Name
High mobility group protein HMGI-C
UniProt Gene Name
HMGA2
UniProt Synonym Gene Names
HMGIC
UniProt Entry Name
HMGA2_HUMAN

NCBI Description

This gene encodes a protein that belongs to the non-histone chromosomal high mobility group (HMG) protein family. HMG proteins function as architectural factors and are essential components of the enhancesome. This protein contains structural DNA-binding domains and may act as a transcriptional regulating factor. Identification of the deletion, amplification, and rearrangement of this gene that are associated with myxoid liposarcoma suggests a role in adipogenesis and mesenchymal differentiation. A gene knock out study of the mouse counterpart demonstrated that this gene is involved in diet-induced obesity. Alternate transcriptional splice variants, encoding different isoforms, have been characterized. [provided by RefSeq, Jul 2008]

Uniprot Description

HMGA2: Functions as a transcriptional regulator. Functions in cell cycle regulation through CCNA2. Plays an important role in chromosome condensation during the meiotic G2/M transition of spermatocytes. Interacts with E4F1. Interacts with NEK2. Belongs to the HMGA family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Oncoprotein

Chromosomal Location of Human Ortholog: 12q15

Cellular Component: nucleoplasm; nuclear chromosome; nucleus

Molecular Function: protein binding; nucleosomal DNA binding; DNA-(apurinic or apyrimidinic site) lyase activity; DNA binding; AT DNA binding; DNA-dependent protein kinase activity; 5'-deoxyribose-5-phosphate lyase activity; SMAD binding; DNA bending activity; transcription factor binding

Biological Process: fat cell differentiation; establishment and/or maintenance of chromatin architecture; positive regulation of apoptosis; multicellular organismal development; positive regulation of transcription, DNA-dependent; mesodermal cell differentiation; negative regulation of transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; base-excision repair; regulation of growth; chondrocyte differentiation; negative regulation of retroviral genome replication; mitosis; transcription, DNA-dependent; heterochromatin formation; response to virus; DNA damage response, detection of DNA damage; stem cell differentiation; DNA catabolic process, endonucleolytic; negative regulation of DNA binding; chromosome condensation; mesenchymal cell differentiation; cell division; mitotic cell cycle G2/M transition DNA damage checkpoint; chromosome breakage; epithelial to mesenchymal transition; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; negative regulation of apoptosis

Disease: Leiomyoma, Uterine

Research Articles on HMGA2

Similar Products

Product Notes

The HMGA2 hmga2 (Catalog #AAA6178561) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HMGA2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HMGA2 hmga2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HMGA2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.