Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Mouse anti-Human HLA-DMB Monoclonal Antibody | anti-HLA-DMB antibody

HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (Biotin)

Gene Names
HLA-DMB; RING7; D6S221E
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HLA-DMB; Monoclonal Antibody; HLA-DMB (DMB; RING7; HLA Class II Histocompatibility Antigen; DM beta Chain; MHC Class II Antigen DMB; Really Interesting New Gene 7 Protein) (Biotin); anti-HLA-DMB antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
2D3
Specificity
Recognizes human HLA-DMB.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HLA-DMB antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa22-129 from human HLA-DMB (NP_002109) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VAHVESTCLLDDAGTPKDFTYCISFNKDLLTCWDPEENKMAPCEFGVLNSLANVLSQHLNQKDTLMQRLRNGLQNCATHTQPFWGSLTNRTRPPSVQVAKTTPFNTRE
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.62kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.62kD).)

Testing Data

(Detection limit for recombinant GST tagged HLA-DMB is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HLA-DMB is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-HLA-DMB antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
28,943 Da
NCBI Official Full Name
HLA class II histocompatibility antigen, DM beta chain
NCBI Official Synonym Full Names
major histocompatibility complex, class II, DM beta
NCBI Official Symbol
HLA-DMB
NCBI Official Synonym Symbols
RING7; D6S221E
NCBI Protein Information
HLA class II histocompatibility antigen, DM beta chain; MHC class II HLA-DMB; MHC class II antigen DMB; MHC class II antigen HLA-DM beta chain; class II histocompatibility antigen, M beta chain; really interesting new gene 7 protein
UniProt Protein Name
HLA class II histocompatibility antigen, DM beta chain
UniProt Gene Name
HLA-DMB
UniProt Synonym Gene Names
DMB; RING7
UniProt Entry Name
DMB_HUMAN

Uniprot Description

HLA-DMB: Plays a critical role in catalyzing the release of class II-associated invariant chain peptide (CLIP) from newly synthesized MHC class II molecules and freeing the peptide binding site for acquisition of antigenic peptides. In B-cells, the interaction between HLA-DM and MHC class II molecules is regulated by HLA-DO. Belongs to the MHC class II family.

Protein type: Vesicle; Membrane protein, integral

Chromosomal Location of Human Ortholog: 6p21.3

Cellular Component: lysosomal membrane; late endosome membrane; integral to membrane; MHC class II protein complex

Biological Process: peptide antigen assembly with MHC class II protein complex; antigen processing and presentation of exogenous peptide antigen via MHC class II; positive regulation of T cell proliferation; immune response; MHC class II protein complex assembly

Similar Products

Product Notes

The HLA-DMB hla-dmb (Catalog #AAA6142292) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HLA-DMB (DMB, RING7, HLA Class II Histocompatibility Antigen, DM beta Chain, MHC Class II Antigen DMB, Really Interesting New Gene 7 Protein) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HLA-DMB can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HLA-DMB hla-dmb for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HLA-DMB, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.