Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged HKR1 is 0.1 ng/ml as a capture antibody.)

Mouse HKR1 Monoclonal Antibody | anti-HKR1 antibody

HKR1 (GLI-Kruppel Family Member HKR1) (PE)

Gene Names
HKR1; ZNF875
Applications
Western Blot
Purity
Purified
Synonyms
HKR1; Monoclonal Antibody; HKR1 (GLI-Kruppel Family Member HKR1) (PE); GLI-Kruppel Family Member HKR1; anti-HKR1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
800000
Specificity
Recognizes HKR1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-HKR1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HKR1 (NP_861451.1, 191aa-290aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
GTSKALSSPPEEQQPAQSKEDNTVVDIGSSPERRADLEETDKVLHGLEVSGFGEIKYEEFGPGFIKESNLLSLQKTQTGETPYMYTEWGDSFGSMSVLIK
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HKR1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HKR1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-HKR1 antibody
Mouse monoclonal antibody raised against a partial recombinant HKR1.
Product Categories/Family for anti-HKR1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
75,128 Da
NCBI Official Full Name
Krueppel-related zinc finger protein 1
NCBI Official Synonym Full Names
HKR1, GLI-Kruppel zinc finger family member
NCBI Official Symbol
HKR1
NCBI Official Synonym Symbols
ZNF875
NCBI Protein Information
Krueppel-related zinc finger protein 1; oncogene HKR1; zinc finger protein 875; GLI-Kruppel family member HKR1
UniProt Protein Name
Krueppel-related zinc finger protein 1
Protein Family
UniProt Gene Name
HKR1
UniProt Synonym Gene Names
ZNF875
UniProt Entry Name
HKR1_HUMAN

Uniprot Description

HKR1: May be involved in transcriptional regulation. Belongs to the krueppel C2H2-type zinc-finger protein family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: C2H2-type zinc finger protein

Chromosomal Location of Human Ortholog: 19q13.12

Cellular Component: nucleus

Molecular Function: DNA binding; metal ion binding

Biological Process: transcription, DNA-dependent; regulation of transcription, DNA-dependent; multicellular organismal development

Similar Products

Product Notes

The HKR1 hkr1 (Catalog #AAA6187826) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HKR1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HKR1 hkr1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HKR1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.