Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Immunoperoxidase of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. [antibody concentration 5ug/ml].)

Mouse anti-Human HIST2H2BE Monoclonal Antibody | anti-HIST2H2BE antibody

HIST2H2BE (H2BFQ, Histone H2B Type 2-E, Histone H2B-GL105, Histone H2B.q, H2B, MGC119802, MGC119804, MGC129733, MGC129734) (HRP)

Gene Names
HIST2H2BE; H2B; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105
Reactivity
Human
Applications
ELISA, Immunohistochemistry
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HIST2H2BE; Monoclonal Antibody; HIST2H2BE (H2BFQ; Histone H2B Type 2-E; Histone H2B-GL105; Histone H2B.q; H2B; MGC119802; MGC119804; MGC129733; MGC129734) (HRP); anti-HIST2H2BE antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
4G6
Specificity
Recognizes human HIST2H2BE.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HIST2H2BE antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin
Application Notes
IHC-P: 5ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa36-127 from HIST2H2BE (NP_003519) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ESYSIYVYKVLKQVHPDTGISSKAMGIMNSFVNDIFERIAGEASRLAHYNKRSTITSREIQTAVRLLLPGELAKHAVSEGTKAVTKYTSSK*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Immunoperoxidase of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. [antibody concentration 5ug/ml].)

Testing Data (Immunoperoxidase of monoclonal antibody to HIST2H2BE on formalin-fixed paraffin-embedded human placenta. [antibody concentration 5ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HIST2H2BE is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HIST2H2BE is ~3ng/ml as a capture antibody.)
Product Categories/Family for anti-HIST2H2BE antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
13,920 Da
NCBI Official Full Name
histone H2B type 2-E
NCBI Official Synonym Full Names
histone cluster 2, H2be
NCBI Official Symbol
HIST2H2BE
NCBI Official Synonym Symbols
H2B; H2BQ; GL105; H2B.1; H2BFQ; H2BGL105
NCBI Protein Information
histone H2B type 2-E; histone H2B.q; histone 2, H2be; histone H2B-GL105; H2B histone family, member Q
UniProt Protein Name
Histone H2B type 2-E
Protein Family
UniProt Gene Name
HIST2H2BE
UniProt Synonym Gene Names
H2BFQ; H2B/q
UniProt Entry Name
H2B2E_HUMAN

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene encodes a member of the histone H2B family, and generates two transcripts through the use of the conserved stem-loop termination motif, and the polyA addition motif. [provided by RefSeq, Jul 2008]

Uniprot Description

H2B2E: Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. Belongs to the histone H2B family.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 1q21.2

Cellular Component: nucleoplasm; extracellular space; nucleosome; nucleus

Molecular Function: DNA binding; protein heterodimerization activity

Biological Process: nucleosome assembly; defense response to Gram-positive bacterium; establishment and/or maintenance of chromatin architecture; innate immune response in mucosa; antibacterial humoral response

Research Articles on HIST2H2BE

Similar Products

Product Notes

The HIST2H2BE hist2h2be (Catalog #AAA6152894) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HIST2H2BE (H2BFQ, Histone H2B Type 2-E, Histone H2B-GL105, Histone H2B.q, H2B, MGC119802, MGC119804, MGC129733, MGC129734) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HIST2H2BE can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin. IHC-P: 5ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HIST2H2BE hist2h2be for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HIST2H2BE, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.