Mouse anti-Human, Rat HIPK2 Monoclonal Antibody | anti-HIPK2 antibody

HIPK2 (Homeodomain Interacting Protein Kinase 2, hHIPk2, DKFZp686K02111, FLJ23711, PRO0593) (Biotin)

Cat. Num. AAA6142281

• Gene Names: HIPK2; PRO0593
• Reactivity: Human, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HIPK2; Monoclonal Antibody; HIPK2 (Homeodomain Interacting Protein Kinase 2; hHIPk2; DKFZp686K02111; FLJ23711; PRO0593) (Biotin); anti-HIPK2 antibody

• Host: Mouse
• Reactivity: Human, Rat
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 4F4
• Specificity: Recognizes human HIPK2. Species Crossreactivity: rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
• Sequence Length: 4000

• Applicable Applications for anti-HIPK2 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa961-1065 from human HIPK2 (AAG41236) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: TGNPRTIIVPPLKTQASEVLVECDSLVPVNTSHHSSSYKSKSSSNVTSTSGHSSGSSSGAITYRQQRPGPHFQQQQPLNLSQAQQHITTDRTGSHRRQQAYITPT*
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.66kD).)

Western Blot (WB)

(HIPK2 monoclonal antibody Western Blot analysis of HIPK2 expression in human ovary cancer.)

Western Blot (WB)

(HIPK2 monoclonal antibody. Western Blot analysis of HIPK2 expression in H9c2(2-1).)

Related Product Information for anti-HIPK2 antibody

HIPK2, a member of the KIPK subfamily of Ser/Thr protein kinases, phosphorylates homeodomain transcription factors. It may play a role as a corepressor for homeodomain transcription factors. This nuclear protein has been shown to interact with TRADD. It is highly expressed in neuronal tissues, heart and kidney, and weakly expressed in a ubiquitous way. HIPK2 is a target for sumoylation, and when conjugated it is directed to nuclear speckles.

Product Categories/Family for anti-HIPK2 antibody

Antibodies; Protein Kinases

NCBI and Uniprot Product Information

• NCBI GI #: 11907598
• NCBI GeneID: 28996
• NCBI Official Full Name: Homo sapiens protein kinase HIPK2 mRNA, complete cds
• NCBI Official Synonym Full Names: homeodomain interacting protein kinase 2
• NCBI Official Symbol: HIPK2
• NCBI Official Synonym Symbols: PRO0593
• NCBI Protein Information: homeodomain-interacting protein kinase 2
• Protein Family: Homeodomain-interacting protein kinase

NCBI Description

This gene encodes a conserved serine/threonine kinase that is a member of the homeodomain-interacting protein kinase family. The encoded protein interacts with homeodomain transcription factors and many other transcription factors such as p53, and can function as both a corepressor and a coactivator depending on the transcription factor and its subcellular localization. Multiple transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2011]