Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M13), clone 2B12.Lane 1: HHEX transfected lysate(30.02 KDa).Lane 2: Non-transfected lysate.)

Mouse HHEX Monoclonal Antibody | anti-HHEX antibody

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (APC)

Gene Names
HHEX; HEX; PRH; HMPH; PRHX; HOX11L-PEN
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified
Synonyms
HHEX; Monoclonal Antibody; HHEX (Hematopoietically Expressed Homeobox; HEX; HMPH; HOX11L-PEN; PRH; PRHX) (APC); Hematopoietically Expressed Homeobox; PRHX; anti-HHEX antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2B12
Specificity
Recognizes HHEX.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HHEX antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HHEX (NP_002720, 133aa-237aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M13), clone 2B12.Lane 1: HHEX transfected lysate(30.02 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M13), clone 2B12.Lane 1: HHEX transfected lysate(30.02 KDa).Lane 2: Non-transfected lysate.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HHEX on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HHEX on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HHEX on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HHEX on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-HHEX antibody
This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq]
Product Categories/Family for anti-HHEX antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
32 kDa (293aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
NCBI Official Full Name
hematopoietically-expressed homeobox protein HHEX
NCBI Official Synonym Full Names
hematopoietically expressed homeobox
NCBI Official Symbol
HHEX
NCBI Official Synonym Symbols
HEX; PRH; HMPH; PRHX; HOX11L-PEN
NCBI Protein Information
hematopoietically-expressed homeobox protein HHEX
UniProt Protein Name
Hematopoietically-expressed homeobox protein HHEX
UniProt Gene Name
HHEX
UniProt Synonym Gene Names
HEX; PRH; PRHX; Homeobox protein HEX
UniProt Entry Name
HHEX_HUMAN

NCBI Description

This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; TATA-binding protein binding; sequence-specific DNA binding; eukaryotic initiation factor 4E binding; chromatin binding; transcription factor binding; DNA bending activity

Biological Process: response to peptide hormone stimulus; negative regulation of transcription from RNA polymerase II promoter; anterior/posterior pattern formation; poly(A)+ mRNA export from nucleus; pancreas development; thyroid gland development; response to wounding; cell differentiation; vasculogenesis; positive regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; negative regulation of vascular endothelial growth factor receptor signaling pathway; transcription, DNA-dependent; in utero embryonic development; multicellular organism growth; negative regulation of cyclin-dependent protein kinase activity; forebrain morphogenesis; interkinetic nuclear migration; regulation of cell proliferation; cell proliferation; negative regulation of angiogenesis; mRNA export from nucleus; B cell differentiation; myeloid leukocyte differentiation; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; endoderm development

Research Articles on HHEX

Similar Products

Product Notes

The HHEX hhex (Catalog #AAA6167819) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HHEX can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HHEX hhex for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HHEX, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.