Mouse HHEX Monoclonal Antibody | anti-HHEX antibody

HHEX (Hematopoietically Expressed Homeobox, HEX, HMPH, HOX11L-PEN, PRH, PRHX) (Biotin)

Cat. Num. AAA6172227

• Gene Names: HHEX; HEX; PRH; HMPH; PRHX; HOX11L-PEN
• Applications: ELISA, Western Blot
• Purity: Purified
• Synonyms: HHEX; Monoclonal Antibody; HHEX (Hematopoietically Expressed Homeobox; HEX; HMPH; HOX11L-PEN; PRH; PRHX) (Biotin); Hematopoietically Expressed Homeobox; PRHX; anti-HHEX antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2b,k
• Clone Number: 2A10
• Specificity: Recognizes HHEX.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HHEX antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HHEX (NP_002720, 133aa-237aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PLHKRKGGQVRFSNDQTIELEKKFETQKYLSPPERKRLAKMLQLSERQVKTWFQNRRAKWRRLKQENPQSNKKEELESLDSSCDQRQDLPSEQNKGASLDSSQCS
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HHEX expression in transfected 293T cell line by HHEX monoclonal antibody (M11), clone 2A10.Lane 1: HHEX transfected lysate(30.02 KDa).Lane 2: Non-transfected lysate.)

Related Product Information for anti-HHEX antibody

This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq]

Product Categories/Family for anti-HHEX antibody

Antibodies; Transcription Factors; Homeobox (HOX)

NCBI and Uniprot Product Information

• NCBI GI #: 4506049
• NCBI GeneID: 3087
• NCBI Accession #: NP_002720
• NCBI GenBank Nucleotide #: NM_002729.4
• UniProt Accession #: Q03014; Q96CE9; B1AQ17
• Molecular Weight: 32 kDa (293aa), confirmed by MALDI-TOF (Molecular size on SDS-PAGE will appear higher)
• NCBI Official Full Name: hematopoietically-expressed homeobox protein HHEX
• NCBI Official Synonym Full Names: hematopoietically expressed homeobox
• NCBI Official Symbol: HHEX
• NCBI Official Synonym Symbols: HEX; PRH; HMPH; PRHX; HOX11L-PEN
• NCBI Protein Information: hematopoietically-expressed homeobox protein HHEX
• UniProt Protein Name: Hematopoietically-expressed homeobox protein HHEX
• Protein Family: Hematopoietically-expressed homeobox protein
• UniProt Gene Name: HHEX
• UniProt Synonym Gene Names: HEX; PRH; PRHX; Homeobox protein HEX
• UniProt Entry Name: HHEX_HUMAN

NCBI Description

This gene encodes a member of the homeobox family of transcription factors, many of which are involved in developmental processes. Expression in specific hematopoietic lineages suggests that this protein may play a role in hematopoietic differentiation. [provided by RefSeq, Jul 2008]

Uniprot Description

HHEX: Recognizes the DNA sequence 5'-ATTAA-3'. Transcriptional repressor. May play a role in hematopoietic differentiation. Establishes anterior identity at two levels; acts early to enhance canonical WNT-signaling by repressing expression of TLE4, and acts later to inhibit NODAL-signaling by directly targeting NODAL.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: 10q23.33

Cellular Component: cytoplasm; nucleus

Molecular Function: protein binding; protein homodimerization activity; TATA-binding protein binding; sequence-specific DNA binding; eukaryotic initiation factor 4E binding; chromatin binding; transcription factor binding; DNA bending activity

Biological Process: response to peptide hormone stimulus; negative regulation of transcription from RNA polymerase II promoter; anterior/posterior pattern formation; poly(A)+ mRNA export from nucleus; pancreas development; thyroid gland development; response to wounding; cell differentiation; vasculogenesis; positive regulation of Wnt receptor signaling pathway; Wnt receptor signaling pathway; negative regulation of vascular endothelial growth factor receptor signaling pathway; transcription, DNA-dependent; in utero embryonic development; multicellular organism growth; negative regulation of cyclin-dependent protein kinase activity; forebrain morphogenesis; interkinetic nuclear migration; regulation of cell proliferation; cell proliferation; negative regulation of angiogenesis; mRNA export from nucleus; B cell differentiation; myeloid leukocyte differentiation; embryonic heart tube development; positive regulation of transcription from RNA polymerase II promoter; negative regulation of transcription, DNA-dependent; endoderm development