Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.01kD).)

Mouse anti-Human Hepatoma Derived Growth Factor Monoclonal Antibody | anti-HDGF antibody

Hepatoma Derived Growth Factor (HDGF, DKFZp686J1764, FLJ96580, High-Mobility Group Protein 1-Like 2, HMG1L2, HMG-1L2) APC

Gene Names
HDGF; HMG1L2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Hepatoma Derived Growth Factor; Monoclonal Antibody; Hepatoma Derived Growth Factor (HDGF; DKFZp686J1764; FLJ96580; High-Mobility Group Protein 1-Like 2; HMG1L2; HMG-1L2) APC; anti-HDGF antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2D6
Specificity
Recognizes human HDGF.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-HDGF antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa184-240 from human HDGF (NP_004485) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLEVERPLPMEVEKNSTPSEPGSGRGPPQEEEEEEDEEEEATKEDAEAPGIRDHESL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.01kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.01kD).)

Testing Data

(Detection limit for recombinant GST tagged HDGF is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HDGF is ~3ng/ml as a capture antibody.)
Related Product Information for anti-HDGF antibody
HDGF is a member of the hepatoma-derived growth factor family. This protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation.
Product Categories/Family for anti-HDGF antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
11.5 kDa (100aa), confirmed by MALDI-TOF.
NCBI Official Full Name
hepatoma-derived growth factor isoform a
NCBI Official Synonym Full Names
heparin binding growth factor
NCBI Official Symbol
HDGF
NCBI Official Synonym Symbols
HMG1L2
NCBI Protein Information
hepatoma-derived growth factor
UniProt Protein Name
Hepatoma-derived growth factor
UniProt Gene Name
HDGF
UniProt Synonym Gene Names
HMG1L2; HDGF; HMG-1L2
UniProt Entry Name
HDGF_HUMAN

NCBI Description

This gene encodes a member of the hepatoma-derived growth factor family. The encoded protein has mitogenic and DNA-binding activity and may play a role in cellular proliferation and differentiation. High levels of expression of this gene enhance the growth of many tumors. This gene was thought initially to be located on chromosome X; however, that location has been determined to correspond to a related pseudogene. Alternatively spliced transcript variants encoding distinct isoforms have been described. [provided by RefSeq, Jan 2016]

Uniprot Description

HDGF: Heparin-binding protein, with mitogenic activity for fibroblasts. Acts as a transcriptional repressor. Belongs to the HDGF family.

Protein type: Transcription regulation; Cytokine

Chromosomal Location of Human Ortholog: 1q23.1

Cellular Component: nucleoplasm; extracellular space; transcriptional repressor complex; cytoplasm

Molecular Function: heparin binding; DNA binding; growth factor activity; nucleotide binding

Biological Process: cell proliferation; unfolded protein response, activation of signaling protein activity; cellular protein metabolic process; transcription, DNA-dependent; unfolded protein response; negative regulation of transcription from RNA polymerase II promoter; signal transduction

Research Articles on HDGF

Similar Products

Product Notes

The HDGF hdgf (Catalog #AAA6136952) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Hepatoma Derived Growth Factor (HDGF, DKFZp686J1764, FLJ96580, High-Mobility Group Protein 1-Like 2, HMG1L2, HMG-1L2) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Hepatoma Derived Growth Factor can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HDGF hdgf for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Hepatoma Derived Growth Factor, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.