Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human HELZ Monoclonal Antibody | anti-HELZ antibody

HELZ (Helicase with Zinc Finger, DKFZp586G1924, Down-regulated in Human Cancers Protein, DHRC, DRHC, HUMORF5, KIAA0054, MGC163454, Probable Helicase With Zinc Finger Domain) (AP)

Gene Names
HELZ; DHRC; DRHC; HUMORF5
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HELZ; Monoclonal Antibody; HELZ (Helicase with Zinc Finger; DKFZp586G1924; Down-regulated in Human Cancers Protein; DHRC; DRHC; HUMORF5; KIAA0054; MGC163454; Probable Helicase With Zinc Finger Domain) (AP); anti-HELZ antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5B2
Specificity
Recognizes human HELZ.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
13817
Applicable Applications for anti-HELZ antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-100 from HELZ (NP_055692) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEDRRAEKSCEQACESLKRQDYEMALKHCTEALLSLGQYSMADFTGPCPLEIERIKIESLLYRIASFLQLKNYVQADEDCRHVLGEGLAKGEDAFRAVLC
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(HELZ monoclonal antibody Western Blot analysis of HELZ expression in Hela NE.)

Western Blot (WB) (HELZ monoclonal antibody Western Blot analysis of HELZ expression in Hela NE.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HELZ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HELZ on formalin-fixed paraffin-embedded human placenta. [antibody concentration 1ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to HELZ on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to HELZ on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HELZ is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HELZ is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-HELZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens helicase with zinc finger (HELZ), transcript variant 1, mRNA
NCBI Official Synonym Full Names
helicase with zinc finger
NCBI Official Symbol
HELZ
NCBI Official Synonym Symbols
DHRC; DRHC; HUMORF5
NCBI Protein Information
probable helicase with zinc finger domain
UniProt Protein Name
Probable helicase with zinc finger domain
UniProt Gene Name
HELZ
UniProt Synonym Gene Names
DRHC; KIAA0054

NCBI Description

HELZ is a member of the superfamily I class of RNA helicases. RNA helicases alter the conformation of RNA by unwinding double-stranded regions, thereby altering the biologic activity of the RNA molecule and regulating access to other proteins (Wagner et al., 1999 [PubMed 10471385]).[supplied by OMIM, Mar 2008]

Uniprot Description

HELZ: May act as an helicase that plays a role in RNA metabolism in multiple tissues and organs within the developing embryo. Belongs to the DNA2/NAM7 helicase family.

Protein type: EC 3.6.1.-; EC 3.6.4.-; Helicase; RNA-binding

Chromosomal Location of Human Ortholog: 17q24.2

Cellular Component: membrane; nucleus

Molecular Function: ATP binding; helicase activity; metal ion binding; protein binding; RNA binding

Research Articles on HELZ

Similar Products

Product Notes

The HELZ helz (Catalog #AAA6131646) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HELZ (Helicase with Zinc Finger, DKFZp586G1924, Down-regulated in Human Cancers Protein, DHRC, DRHC, HUMORF5, KIAA0054, MGC163454, Probable Helicase With Zinc Finger Domain) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HELZ can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HELZ helz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HELZ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.