Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (31.68kD).)

Mouse anti-Human HCRTR2 Monoclonal Antibody | anti-HCRTR2 antibody

HCRTR2 (Orexin Receptor Type 2, Ox-2-R, Ox2-R, Ox2R, Hypocretin Receptor Type 2) (HRP)

Gene Names
HCRTR2; OX2R
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HCRTR2; Monoclonal Antibody; HCRTR2 (Orexin Receptor Type 2; Ox-2-R; Ox2-R; Ox2R; Hypocretin Receptor Type 2) (HRP); anti-HCRTR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1E3
Specificity
Recognizes human HCRTR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-HCRTR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1-54 from human HCRTR2 (NP_001517) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSGTKLEDSPPCRNWSSASELNETQEPFLNPTDYDDEEFLRYLWREYLHPKEYE
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (31.68kD).)

Western Blot (WB) (Western Blot detection against Immunogen (31.68kD).)

Western Blot (WB)

(Western Blot analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody Lane 1: HCRTR2 transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HCRTR2 expression in transfected 293T cell line by HCRTR2 monoclonal antibody Lane 1: HCRTR2 transfected lysate (50.7kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HCRTR2 is ~0.03ng/ml as a capture antibody)

Testing Data (Detection limit for recombinant GST tagged HCRTR2 is ~0.03ng/ml as a capture antibody)

Western Blot (WB)

(Western blot analysis of HCRTR2 over-expressed 293 cell line, cotransfected with HCRTR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCRTR2 monoclonal GAPDH (36.1kD) used as specificity and loading control.)

Western Blot (WB) (Western blot analysis of HCRTR2 over-expressed 293 cell line, cotransfected with HCRTR2 Validated Chimera RNAi (Lane 2) or non-transfected control (Lane 1). Blot probed with HCRTR2 monoclonal GAPDH (36.1kD) used as specificity and loading control.)
Related Product Information for anti-HCRTR2 antibody
Orexin receptor type 2 is a nonselective, high-affinity receptor for both orexin-A and orexin-B neuropeptides. It is involved in the central feedback mechanism that regulates feeding behavior. It is a transmembrane protein and belongs to the G-protein coupled receptor 1 family.
Product Categories/Family for anti-HCRTR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
50,694 Da
NCBI Official Full Name
orexin receptor type 2
NCBI Official Synonym Full Names
hypocretin (orexin) receptor 2
NCBI Official Symbol
HCRTR2
NCBI Official Synonym Symbols
OX2R
NCBI Protein Information
orexin receptor type 2
Protein Family

NCBI Description

The protein encoded by this gene is a G-protein coupled receptor involved in the regulation of feeding behavior. The encoded protein binds the hypothalamic neuropeptides orexin A and orexin B. A related gene (HCRTR1) encodes a G-protein coupled receptor that selectively binds orexin A. [provided by RefSeq, Jan 2009]

Research Articles on HCRTR2

Similar Products

Product Notes

The HCRTR2 (Catalog #AAA6152842) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HCRTR2 (Orexin Receptor Type 2, Ox-2-R, Ox2-R, Ox2R, Hypocretin Receptor Type 2) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HCRTR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HCRTR2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HCRTR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.