Mouse HCN4 Monoclonal Antibody | anti-HCN4 antibody

HCN4 (hyperpolarization Activated cyclic Nucleotide-gated Potassium Channel 4) (Biotin)

Cat. Num. AAA6174384

• Gene Names: HCN4; SSS2
• Applications: Western Blot
• Purity: Purified
• Synonyms: HCN4; Monoclonal Antibody; HCN4 (hyperpolarization Activated cyclic Nucleotide-gated Potassium Channel 4) (Biotin); hyperpolarization Activated cyclic Nucleotide-gated Potassium Channel 4; anti-HCN4 antibody

• Host: Mouse
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2A5
• Specificity: Recognizes HCN4.
• Purity/Purification: Purified
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.

• Applicable Applications for anti-HCN4 antibody: Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: HCN4 (NP_005468.1, 1105aa-1203aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: SPHSSGESMAAFPLFPRAGGGSGGSGSSGGLGPPGRPYGAIPGQHVTLPRKTSSGSLPPPLSLFGARATSSGGPPLTAGPQREPGARPEPVRSKLPSNL
• Conjugate: Biotin
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged HCN4 is 0.1 ng/ml as a capture antibody.)

Related Product Information for anti-HCN4 antibody

This gene encodes a member of the hyperpolarization-activated cyclic nucleotide-gated potassium channels. The encoded protein shows slow kinetics of activation and inactivation, and is necessary for the cardiac pacemaking process. This channel may also mediate responses to sour stimuli. Mutations in this gene have been linked to sick sinus syndrome 2, also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. Two pseudogenes have been identified on chromosome 15. [provided by RefSeq]

Product Categories/Family for anti-HCN4 antibody

Antibodies; Ion Channel

NCBI and Uniprot Product Information

• NCBI GI #: 4885407
• NCBI GeneID: 10021
• NCBI Accession #: NP_005468.1
• NCBI GenBank Nucleotide #: NM_005477.2
• UniProt Accession #: Q9Y3Q4; Q9UMQ7
• Molecular Weight: 129,042 Da
• NCBI Official Full Name: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
• NCBI Official Synonym Full Names: hyperpolarization activated cyclic nucleotide gated potassium channel 4
• NCBI Official Symbol: HCN4
• NCBI Official Synonym Symbols: SSS2
• NCBI Protein Information: potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
• UniProt Protein Name: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 4
• Protein Family: Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel
• UniProt Gene Name: HCN4

NCBI Description

This gene encodes a member of the hyperpolarization-activated cyclic nucleotide-gated potassium channels. The encoded protein shows slow kinetics of activation and inactivation, and is necessary for the cardiac pacemaking process. This channel may also mediate responses to sour stimuli. Mutations in this gene have been linked to sick sinus syndrome 2, also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. Two pseudogenes have been identified on chromosome 15. [provided by RefSeq, Oct 2008]

Uniprot Description

HCN4: Hyperpolarization-activated ion channel with very slow activation and inactivation exhibiting weak selectivity for potassium over sodium ions. May contribute to the native pacemaker currents in heart (If) and in neurons (Ih). Activated by cAMP. May mediate responses to sour stimuli. Defects in HCN4 are a cause of sick sinus syndrome type 2 (SSS2); also known as atrial fibrillation with bradyarrhythmia or familial sinus bradycardia. The term 'sick sinus syndrome' encompasses a variety of conditions caused by sinus node dysfunction. The most common clinical manifestations are syncope, presyncope, dizziness, and fatigue. Electrocardiogram typically shows sinus bradycardia, sinus arrest, and/or sinoatrial block. Episodes of atrial tachycardias coexisting with sinus bradycardia ('tachycardia-bradycardia syndrome') are also common in this disorder. SSS occurs most often in the elderly associated with underlying heart disease or previous cardiac surgery, but can also occur in the fetus, infant, or child without heart disease or other contributing factors, in which case it is considered to be a congenital disorder. Defects in HCN4 are the cause of Brugada syndrome type 8 (BRGDA8). A tachyarrhythmia characterized by right bundle branch block and ST segment elevation on an electrocardiogram (ECG). It can cause the ventricles to beat so fast that the blood is prevented from circulating efficiently in the body. When this situation occurs (called ventricular fibrillation), the individual will faint and may die in a few minutes if the heart is not reset. Belongs to the potassium channel HCN family.

Protein type: Channel, cation; Membrane protein, integral; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 15q24.1

Cellular Component: intrinsic component of plasma membrane; perinuclear region of cytoplasm; plasma membrane

Molecular Function: cAMP binding; identical protein binding; intracellular cAMP activated cation channel activity; voltage-gated potassium channel activity; voltage-gated sodium channel activity

Biological Process: blood circulation; cation transport; muscle contraction; regulation of heart rate; regulation of membrane potential; regulation of postsynaptic membrane potential

Disease: Brugada Syndrome 8; Sick Sinus Syndrome 2, Autosomal Dominant