<
Western Blot (WB)
(Western Blot analysis of 246948 in K-562 cell lysates. This demonstrates that 246948 detected the HCLS1 protein (arrow).)
Mouse HCLS1 Monoclonal Antibody | anti-HCLS1 antibody
HCLS1 (Hematopoietic Cell-Specific Lyn Substrate 1, CTTNL, HS1) (AP)
Gene Names
HCLS1; HS1; p75; CTTNL; lckBP1
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HCLS1; Monoclonal Antibody; HCLS1 (Hematopoietic Cell-Specific Lyn Substrate 1; CTTNL; HS1) (AP); Hematopoietic Cell-Specific Lyn Substrate 1; HS1; anti-HCLS1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2A9
Specificity
Recognizes human HCLS1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Sequence Length
486
Applicable Applications for anti-HCLS1 antibody
ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant protein corresponding to aa266-355 from human HCLS1with a GST Tag (AAH16758). MW of the GST tag alone is 26kD.
Immunogen Sequence
QERKAVTKRSPEAPQPVIAMEEPAVPAPLPKKISSEAWPPVGTPPSSESEPVRTSREHPVPLLPIRQTLPEDNEEPPALPPRTLEGLQVE
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Western Blot (WB)
(Western Blot analysis of 246948 in K-562 cell lysates. This demonstrates that 246948 detected the HCLS1 protein (arrow).)
Western Blot (WB)
(Western Blot analysis of 246948 in K-562 cell lysates. This demonstrates that 246948 detected the HCLS1 protein (arrow).)
Testing Data
(Detection limit for recombinant GST tagged 246948 is approximately 0.3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged 246948 is approximately 0.3ng/ml as a capture antibody.)
Immunohistochemistry (IHC)
(Immunohistochemistry analysis in formalin-fixed and paraffin-embedded human small intestine using 246948, which was peroxidase-conjuagted to the secondary antibody followed by DAB staining. [antibody concentration 3 ug/ml])
Immunohistochemistry (IHC)
(Immunohistochemistry analysis in formalin-fixed and paraffin-embedded human small intestine using 246948, which was peroxidase-conjuagted to the secondary antibody followed by DAB staining. [antibody concentration 3 ug/ml])
Testing Data
()
Testing Data
()
Related Product Information for anti-HCLS1 antibody
Mouse monoclonal antibody raised against a partial recombinant HCLS1.
Product Categories/Family for anti-HCLS1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Official Full Name
Hematopoietic cell-specific Lyn substrate 1
NCBI Official Synonym Full Names
hematopoietic cell-specific Lyn substrate 1
NCBI Official Symbol
HCLS1
NCBI Official Synonym Symbols
HS1; p75; CTTNL; lckBP1
NCBI Protein Information
hematopoietic lineage cell-specific protein
Protein Family
Research Articles on HCLS1
Similar Products
Product Notes
The HCLS1 (Catalog #AAA6163486) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HCLS1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HCLS1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HCLS1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
