Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10.Lane 1: HBZ transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.)

Mouse HBZ Monoclonal Antibody | anti-HBZ antibody

HBZ (Hemoglobin, zeta) (AP)

Gene Names
HBZ; HBZ1; HBZ-T1
Applications
Immunohistochemistry, Western Blot
Purity
Purified
Synonyms
HBZ; Monoclonal Antibody; HBZ (Hemoglobin; zeta) (AP); Hemoglobin; zeta; anti-HBZ antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1G10
Specificity
Recognizes HBZ.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HBZ antibody
Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HBZ (NP_005323, 1aa-81aa) full length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MSLTKTERTIIVSMWAKISTQADTIGTETLERLFLSHPQTKTYFPHFDLHPGSAQLRAHGSKVVAAVGDAVKSIDDIGGAL
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10.Lane 1: HBZ transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HBZ expression in transfected 293T cell line by HBZ monoclonal antibody (M03), clone 1G10.Lane 1: HBZ transfected lysate(15.6 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HBZ is approximately 10ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HBZ is approximately 10ng/ml as a capture antibody.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HBZ on formalin-fixed paraffin-embedded human prostate. [antibody concentration 3 ug/ml])
Product Categories/Family for anti-HBZ antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
16.7kDa (150aa), confirmed by MALDI-TOF
NCBI Official Full Name
hemoglobin subunit zeta
NCBI Official Synonym Full Names
hemoglobin subunit zeta
NCBI Official Symbol
HBZ
NCBI Official Synonym Symbols
HBZ1; HBZ-T1
NCBI Protein Information
hemoglobin subunit zeta
UniProt Protein Name
Hemoglobin subunit zeta
Protein Family
UniProt Gene Name
HBZ
UniProt Synonym Gene Names
HBZ2
UniProt Entry Name
HBAZ_HUMAN

NCBI Description

Zeta-globin is an alpha-like hemoglobin. The zeta-globin polypeptide is synthesized in the yolk sac of the early embryo, while alpha-globin is produced throughout fetal and adult life. The zeta-globin gene is a member of the human alpha-globin gene cluster that includes five functional genes and two pseudogenes. The order of genes is: 5' - zeta - pseudozeta - mu - pseudoalpha-1 - alpha-2 -alpha-1 - theta1 - 3'. [provided by RefSeq, Nov 2009]

Uniprot Description

HBZ: The zeta chain is an alpha-type chain of mammalian embryonic hemoglobin, synthesized primarily in the yolk sac. Belongs to the globin family.

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: hemoglobin complex

Molecular Function: protein binding; iron ion binding; heme binding; oxygen binding; oxygen transporter activity

Biological Process: erythrocyte maturation; oxygen transport; negative regulation of transcription from RNA polymerase II promoter

Research Articles on HBZ

Similar Products

Product Notes

The HBZ hbz (Catalog #AAA6163405) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HBZ can be used in a range of immunoassay formats including, but not limited to, Immunohistochemistry (IHC), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HBZ hbz for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HBZ, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.