Mouse anti-Human HBB Monoclonal Antibody | anti-HBB antibody

HBB (Hemoglobin Subunit beta, Beta-globin, Hemoglobin beta Chain) (HRP)

Cat. Num. AAA6152834

• Gene Names: HBB; CD113t-C; beta-globin
• Reactivity: Human
• Applications: ELISA, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HBB; Monoclonal Antibody; HBB (Hemoglobin Subunit beta; Beta-globin; Hemoglobin beta Chain) (HRP); anti-HBB antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 7B12
• Specificity: Recognizes human HBB.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).

• Applicable Applications for anti-HBB antibody: ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
• Application Notes: IHC-P: 3ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa38-147 from human HBB (AAH07075) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: WTQRFFESFGDLSTPDAVMGNPKVKAHGKKVLGAFSDGLAHLDNLKGTFATLSELHCDKLHVDPENFRLLGNVLVCVLAHHFGKEFTPPVQAAYQKVVAGVANALAHKYH
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HBB on formalin-fixed paraffin-embedded human lung. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged HBB is ~0.1ng/ml as a capture antibody.)

Product Categories/Family for anti-HBB antibody

Antibodies; Serum Proteins

References

1. Hemoglobin ? and ?] are ubiquitous in the human lung, decline in idiopathic pulmonary fibrosis but not in COPD. Ishikawa N, Ohlmeier S, Salmenkivi K, Myllarniemi M, Rahman I, Mazur W, Kinnula VL.Respir Res. 2010 Sep 13;11:123.

NCBI and Uniprot Product Information

• NCBI GI #: 13937928
• NCBI GeneID: 3043
• Molecular Weight: 15,998 Da
• NCBI Official Full Name: Homo sapiens hemoglobin, beta, mRNA
• NCBI Official Synonym Full Names: hemoglobin subunit beta
• NCBI Official Symbol: HBB
• NCBI Official Synonym Symbols: CD113t-C; beta-globin
• NCBI Protein Information: hemoglobin subunit beta
• Protein Family: Hemoglobin

NCBI Description

The alpha (HBA) and beta (HBB) loci determine the structure of the 2 types of polypeptide chains in adult hemoglobin, Hb A. The normal adult hemoglobin tetramer consists of two alpha chains and two beta chains. Mutant beta globin causes sickle cell anemia. Absence of beta chain causes beta-zero-thalassemia. Reduced amounts of detectable beta globin causes beta-plus-thalassemia. The order of the genes in the beta-globin cluster is 5'-epsilon -- gamma-G -- gamma-A -- delta -- beta--3'. [provided by RefSeq, Jul 2008]