Mouse anti-Human HBA1 Monoclonal Antibody | anti-HBA1 antibody

HBA1 (HBA2, Hemoglobin Subunit alpha, Alpha-globin, Hemoglobin alpha Chain, MGC126895, MGC126897) (PE)

Cat. Num. AAA6158136

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: HBA1; Monoclonal Antibody; HBA1 (HBA2; Hemoglobin Subunit alpha; Alpha-globin; Hemoglobin alpha Chain; MGC126895; MGC126897) (PE); anti-HBA1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 4F9
• Specificity: Recognizes human HBA1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
• Sequence Length: 142

• Applicable Applications for anti-HBA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa33-142 from human HBA1 (NP_000549) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MFLSFPTTKTYFPHFDLSHGSAQVKGHGKKVADALTNAVAHVDDMPNALSALSDLHAHKLRVDPVNFKLLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVSTVLTSKYR
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.84kD).)

Western Blot (WB)

(HBA1 monoclonal antibody. Western Blot analysis of HBA1 expression in human placenta.)

Product Categories/Family for anti-HBA1 antibody

Antibodies; Hemoglobin

References

1. The differentiating and apoptotic effects of 2-aza-5'-deoxycytidine are dependent on the PU.1 expression level in PU.1-transgenic K562 cells. Aoyama S, Nakano H, Danbara M, Higashihara M, Harigae H, Takahashi S.Biochem Biophys Res Commun. 2012 Mar 20.

NCBI and Uniprot Product Information

• NCBI GI #: 4504347
• NCBI Accession #: NP_000549
• NCBI GenBank Nucleotide #: NM_000558
• UniProt Accession #: P69905
• NCBI Official Full Name: hemoglobin subunit alpha
• UniProt Protein Name: Hemoglobin subunit alpha
• Protein Family: Hemoglobin
• UniProt Gene Name: HBA1
• UniProt Entry Name: HBA_HUMAN

Uniprot Description

HBA1: Involved in oxygen transport from the lung to the various peripheral tissues. Defects in HBA1 may be a cause of Heinz body anemias (HEIBAN). This is a form of non-spherocytic hemolytic anemia of Dacie type 1. After splenectomy, which has little benefit, basophilic inclusions called Heinz bodies are demonstrable in the erythrocytes. Before splenectomy, diffuse or punctate basophilia may be evident. Most of these cases are probably instances of hemoglobinopathy. The hemoglobin demonstrates heat lability. Heinz bodies are observed also with the Ivemark syndrome (asplenia with cardiovascular anomalies) and with glutathione peroxidase deficiency. Defects in HBA1 are the cause of alpha-thalassemia (A- THAL). The thalassemias are the most common monogenic diseases and occur mostly in Mediterranean and Southeast Asian populations. The hallmark of alpha-thalassemia is an imbalance in globin-chain production in the adult HbA molecule. The level of alpha chain production can range from none to very nearly normal levels. Deletion of both copies of each of the two alpha-globin genes causes alpha(0)-thalassemia, also known as homozygous alpha thalassemia. Due to the complete absence of alpha chains, the predominant fetal hemoglobin is a tetramer of gamma-chains (Bart hemoglobin) that has essentially no oxygen carrying capacity. This causes oxygen starvation in the fetal tissues leading to prenatal lethality or early neonatal death. The loss of three alpha genes results in high levels of a tetramer of four beta chains (hemoglobin H), causing a severe and life-threatening anemia known as hemoglobin H disease. Untreated, most patients die in childhood or early adolescence. The loss of two alpha genes results in mild alpha-thalassemia, also known as heterozygous alpha-thalassemia. Affected individuals have small red cells and a mild anemia (microcytosis). If three of the four alpha-globin genes are functional, individuals are completely asymptomatic. Some rare forms of alpha-thalassemia are due to point mutations (non- deletional alpha-thalassemia). The thalassemic phenotype is due to unstable globin alpha chains that are rapidly catabolized prior to formation of the alpha-beta heterotetramers. Alpha(0)-thalassemia is associated with non-immune hydrops fetalis, a generalized edema of the fetus with fluid accumulation in the body cavities due to non-immune causes. Non- immune hydrops fetalis is not a diagnosis in itself but a symptom, a feature of many genetic disorders, and the end-stage of a wide variety of disorders. Defects in HBA1 are the cause of hemoglobin H disease (HBH). HBH is a form of alpha-thalassemia due to the loss of three alpha genes. This results in high levels of a tetramer of four beta chains (hemoglobin H), causing a severe and life-threatening anemia. Untreated, most patients die in childhood or early adolescence. Belongs to the globin family.

Protein type: Carrier

Chromosomal Location of Human Ortholog: 16p13.3

Cellular Component: membrane; hemoglobin complex; extracellular region; cytosol

Molecular Function: haptoglobin binding; protein binding; peroxidase activity; iron ion binding; heme binding; oxygen binding; oxygen transporter activity

Biological Process: receptor-mediated endocytosis; response to hydrogen peroxide; oxygen transport; bicarbonate transport; protein heterooligomerization; hydrogen peroxide catabolic process

Disease: Hemoglobin H Disease; Heinz Body Anemias; Alpha-thalassemia