Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Mouse anti-Human HAX1 Monoclonal Antibody | anti-HAX1 antibody

HAX1 (HS1BP1, HCLS1-associated Protein X-1, HS1-associating Protein X-1, HS1-binding Protein 1) (HRP)

Gene Names
HAX1; SCN3; HS1BP1; HCLSBP1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HAX1; Monoclonal Antibody; HAX1 (HS1BP1; HCLS1-associated Protein X-1; HS1-associating Protein X-1; HS1-binding Protein 1) (HRP); anti-HAX1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1D2
Specificity
Recognizes human HAX1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1109
Applicable Applications for anti-HAX1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa76-174 from HAX1 (NP_006109) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
HDNFGFDDLVRDFNSIFSDMGAWTLPSHPPELPGPESETPGERLREGQTLRDSMLKYPDSHQPRIFGGVLESDARSESPQPAPDWGSQRPFHRFDDVWP
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37kD).)

Western Blot (WB)

(Western Blot analysis of HAX1 expression in transfected 293T cell line by HAX1 monoclonal antibody. Lane 1: HAX1 transfected lysate (31.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HAX1 expression in transfected 293T cell line by HAX1 monoclonal antibody. Lane 1: HAX1 transfected lysate (31.6kD). Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged HAX1 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HAX1 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-HAX1 antibody
The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene.
Product Categories/Family for anti-HAX1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens HCLS1 associated protein X-1 (HAX1), transcript variant 1, mRNA
NCBI Official Synonym Full Names
HCLS1 associated protein X-1
NCBI Official Symbol
HAX1
NCBI Official Synonym Symbols
SCN3; HS1BP1; HCLSBP1
NCBI Protein Information
HCLS1-associated protein X-1
UniProt Protein Name
HCLS1-associated protein X-1
Protein Family
UniProt Gene Name
HAX1
UniProt Synonym Gene Names
HS1BP1; HAX-1; HSP1BP-1
UniProt Entry Name
HAX1_HUMAN

NCBI Description

The protein encoded by this gene is known to associate with hematopoietic cell-specific Lyn substrate 1, a substrate of Src family tyrosine kinases. It also interacts with the product of the polycystic kidney disease 2 gene, mutations in which are associated with autosomal-dominant polycystic kidney disease, and with the F-actin-binding protein, cortactin. It was earlier thought that this gene product is mainly localized in the mitochondria, however, recent studies indicate it to be localized in the cell body. Mutations in this gene result in autosomal recessive severe congenital neutropenia, also known as Kostmann disease. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

HAX1: Promotes cell survival. Potentiates GNA13-mediated cell migration. Involved in the clathrin-mediated endocytosis pathway. May be involved in internalization of ABC transporters such as ABCB11. May inhibit CASP9 and CASP3. May regulate intracellular calcium pools. Defects in HAX1 are the cause of neutropenia severe congenital autosomal recessive type 3 (SCN3); also known as Kostmann disease. A disorder of hematopoiesis characterized by maturation arrest of granulopoiesis at the level of promyelocytes with peripheral blood absolute neutrophil counts below 0.5 x 10(9)/l and early onset of severe bacterial infections. Some patients affected by severe congenital neutropenia type 3 have neurological manifestations such as psychomotor retardation and seizures. The clinical phenotype due to HAX1 deficiency appears to depend on the localization of the mutations and their influence on the transcript variants. Mutations affecting exclusively isoform 1 are associated with isolated congenital neutropenia, whereas mutations affecting both isoform 1 and isoform 5 are associated with additional neurologic symptoms. Belongs to the HAX1 family. 6 isoforms of the human protein are produced by alternative splicing.

Protein type: Endoplasmic reticulum; Mitochondrial; Apoptosis; Vesicle

Chromosomal Location of Human Ortholog: 1q21.3

Cellular Component: transcription factor complex; nuclear membrane; clathrin-coated vesicle; mitochondrion; sarcoplasmic reticulum; endoplasmic reticulum; lamellipodium; apical plasma membrane; nuclear envelope; actin cytoskeleton

Molecular Function: protein domain specific binding; protein binding; protein N-terminus binding; interleukin-1 binding

Biological Process: positive regulation of phosphoinositide 3-kinase cascade; regulation of apoptosis; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; regulation of actin filament polymerization; positive regulation of granulocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; positive regulation of peptidyl-serine phosphorylation

Disease: Neutropenia, Severe Congenital, 3, Autosomal Recessive

Research Articles on HAX1

Similar Products

Product Notes

The HAX1 hax1 (Catalog #AAA6152832) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAX1 (HS1BP1, HCLS1-associated Protein X-1, HS1-associating Protein X-1, HS1-binding Protein 1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAX1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAX1 hax1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAX1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.