Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M07), clone 1C7.Lane 1: HAND2 transfected lysate(20.3 KDa).Lane 2: Non-transfected lysate.)

Mouse HAND2 Monoclonal Antibody | anti-HAND2 antibody

HAND2 (Heart and Neural Crest Derivatives Expressed 2, DHAND2, FLJ16260, Hed, MGC125303, MGC125304, Thing2, bHLHa26, dHand) (AP)

Gene Names
HAND2; Hed; dHand; DHAND2; Thing2; bHLHa26
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
HAND2; Monoclonal Antibody; HAND2 (Heart and Neural Crest Derivatives Expressed 2; DHAND2; FLJ16260; Hed; MGC125303; MGC125304; Thing2; bHLHa26; dHand) (AP); Heart and Neural Crest Derivatives Expressed 2; dHand; anti-HAND2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1C7
Specificity
Recognizes HAND2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-HAND2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HAND2 (NP_068808.1, 135aa-216aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LSKIKTLRLATSYIAYLMDLLAKDDQNGEAEAFKAEIKKTDVKEEKRKKELNEILKSTVSSNDKKTKGRTGWPQHVWALELK
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M07), clone 1C7.Lane 1: HAND2 transfected lysate(20.3 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of HAND2 expression in transfected 293T cell line by HAND2 monoclonal antibody (M07), clone 1C7.Lane 1: HAND2 transfected lysate(20.3 KDa).Lane 2: Non-transfected lysate.)
Related Product Information for anti-HAND2 antibody
The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq]
Product Categories/Family for anti-HAND2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
20,269 Da
NCBI Official Full Name
Homo sapiens heart and neural crest derivatives expressed 2 (HAND2), mRNA
NCBI Official Synonym Full Names
heart and neural crest derivatives expressed 2
NCBI Official Symbol
HAND2
NCBI Official Synonym Symbols
Hed; dHand; DHAND2; Thing2; bHLHa26
NCBI Protein Information
heart- and neural crest derivatives-expressed protein 2; basic helix-loop-helix transcription factor HAND2; class A basic helix-loop-helix protein 26; deciduum, heart, autonomic nervous system and neural crest derivatives-expressed protein 2

NCBI Description

The protein encoded by this gene belongs to the basic helix-loop-helix family of transcription factors. This gene product is one of two closely related family members, the HAND proteins, which are asymmetrically expressed in the developing ventricular chambers and play an essential role in cardiac morphogenesis. Working in a complementary fashion, they function in the formation of the right ventricle and aortic arch arteries, implicating them as mediators of congenital heart disease. In addition, this transcription factor plays an important role in limb and branchial arch development. [provided by RefSeq, Jul 2008]

Research Articles on HAND2

Similar Products

Product Notes

The HAND2 (Catalog #AAA6161829) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HAND2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAND2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAND2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.