Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Mouse anti-Human HAMP Monoclonal Antibody | anti-HAMP antibody

HAMP (Hepcidin, Liver-expressed Antimicrobial Peptide 1, LEAP-1, Putative Liver Tumor Regressor, PLTR, HEPC, LEAP1, UNQ487/PRO1003) (Biotin)

Gene Names
HAMP; HEPC; PLTR; HFE2B; LEAP1
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
HAMP; Monoclonal Antibody; HAMP (Hepcidin; Liver-expressed Antimicrobial Peptide 1; LEAP-1; Putative Liver Tumor Regressor; PLTR; HEPC; LEAP1; UNQ487/PRO1003) (Biotin); anti-HAMP antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1F9
Specificity
Recognizes human HAMP.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-HAMP antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa25-85 from human HAMP (AAH20612) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
SVFPQQTGQLAELQPQDRAGARASWMPMFQRRRRRDTHFPICIFCCGCCHRSKCGMCCKT
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (32.71kD).)

Western Blot (WB) (Western Blot detection against Immunogen (32.71kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to HAMP on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to HAMP on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged HAMP is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged HAMP is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-HAMP antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
9,408 Da
NCBI Official Full Name
Homo sapiens hepcidin antimicrobial peptide, mRNA
NCBI Official Synonym Full Names
hepcidin antimicrobial peptide
NCBI Official Symbol
HAMP
NCBI Official Synonym Symbols
HEPC; PLTR; HFE2B; LEAP1
NCBI Protein Information
hepcidin
Protein Family

NCBI Description

The product encoded by this gene is involved in the maintenance of iron homeostasis, and it is necessary for the regulation of iron storage in macrophages, and for intestinal iron absorption. The preproprotein is post-translationally cleaved into mature peptides of 20, 22 and 25 amino acids, and these active peptides are rich in cysteines, which form intramolecular bonds that stabilize their beta-sheet structures. These peptides exhibit antimicrobial activity against bacteria and fungi. Mutations in this gene cause hemochromatosis type 2B, also known as juvenile hemochromatosis, a disease caused by severe iron overload that results in cardiomyopathy, cirrhosis, and endocrine failure. [provided by RefSeq, Oct 2014]

Research Articles on HAMP

Similar Products

Product Notes

The HAMP (Catalog #AAA6142222) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The HAMP (Hepcidin, Liver-expressed Antimicrobial Peptide 1, LEAP-1, Putative Liver Tumor Regressor, PLTR, HEPC, LEAP1, UNQ487/PRO1003) (Biotin) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's HAMP can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAMP for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAMP, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.