Testing Data
(Detection limit for recombinant GST tagged HAGHL is 0.3 ng/ml as a capture antibody.)
Mouse HAGHL Monoclonal Antibody | anti-HAGHL antibody
HAGHL (Hydroxyacylglutathione Hydrolase-like, MGC2605) (PE)
Applications
Western Blot
Purity
Purified
Synonyms
HAGHL; Monoclonal Antibody; HAGHL (Hydroxyacylglutathione Hydrolase-like; MGC2605) (PE); Hydroxyacylglutathione Hydrolase-like; MGC2605; anti-HAGHL antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5B12
Specificity
Recognizes HAGHL.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
282
Applicable Applications for anti-HAGHL antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
HAGHL (NP_115680.1, 183aa-282aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QKVEPCNDHVRAKLSWAKKRDEDDVPTVPSTLGEERLYNPFLRVAEEPVRKFTGKAVPADVLEALCKERARFEQAGEPRQPQARALLALQWGLLSAAPHD
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged HAGHL is 0.3 ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged HAGHL is 0.3 ng/ml as a capture antibody.)
Western Blot (WB)
(HAGHL monoclonal antibody (M01), clone 5B12. Western Blot analysis of HAGHL expression in MCF-7.)
Western Blot (WB)
(HAGHL monoclonal antibody (M01), clone 5B12. Western Blot analysis of HAGHL expression in MCF-7.)
Related Product Information for anti-HAGHL antibody
Mouse monoclonal antibody raised against a partial recombinant HAGHL.
Product Categories/Family for anti-HAGHL antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
hydroxyacylglutathione hydrolase-like protein isoform 2
UniProt Protein Name
Hydroxyacylglutathione hydrolase-like protein
Protein Family
UniProt Gene Name
HAGHL
UniProt Entry Name
HAGHL_HUMAN
Uniprot Description
HAGHL: Hydrolase acting on ester bonds (Potential). Belongs to the metallo-beta-lactamase superfamily. Glyoxalase II family. 4 isoforms of the human protein are produced by alternative splicing.
Protein type: Carbohydrate Metabolism - pyruvate; EC 3.1.2.-; Hydrolase
Chromosomal Location of Human Ortholog: 16p13.3
Molecular Function: hydrolase activity; metal ion binding
Biological Process: metabolic process
Similar Products
Product Notes
The HAGHL haghl (Catalog #AAA6187863) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's HAGHL can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the HAGHL haghl for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "HAGHL, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
