Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (40.7kD).)

Mouse anti-Human H3F3B Monoclonal Antibody | anti-H3F3B antibody

H3F3B (H3 Histone, Family 3B, H3.3B) (HRP)

Gene Names
H3-3B; H3-3A; H3.3B; H3F3B
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
H3F3B; Monoclonal Antibody; H3F3B (H3 Histone; Family 3B; H3.3B) (HRP); anti-H3F3B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2D7-H1
Specificity
Recognizes human H3F3B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Sequence Length
1119
Applicable Applications for anti-H3F3B antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa1-136 from human H3F3B (AAH17558) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MARTKQTARKSTGGKAPRKQLATKAARKSAPSTGGVKKPHRYRPGTVALREIRRYQKSTELLIRKLPFQRLVREIAQDFKTDLRFQSAAIGALQEASEAYLVGLFEDTNLCAIHAKRVTIMPKDIQLARRIRGERA
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (40.7kD).)

Western Blot (WB) (Western Blot detection against Immunogen (40.7kD).)

Western Blot (WB)

(Western Blot analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody. Lane 1: H3F3B transfected lysate (15kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of H3F3B expression in transfected 293T cell line by H3F3B monoclonal antibody. Lane 1: H3F3B transfected lysate (15kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to H3F3B on formalin-fixed paraffin-embedded human liver. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to H3F3B on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to H3F3B on HeLa cell. [antibody concentration 10ug/ml])
Product Categories/Family for anti-H3F3B antibody
References
1. A Developmental Requirement for HIRA-Dependent H3.3 Deposition Revealed at Gastrulation inXenopus. Szenker E, Lacoste N, Almouzni G.Cell Reports (2012), doi:10.1016/ j.celrep.2012.05.006 2. The death-associated protein DAXX is a novel histone chaperone involved in the replication-independent deposition of H3.3. Drane P, Ouararhni K, Depaux A, Shuaib M, Hamiche A.Genes Dev. 2010 Jun 15;24(12):1253-65. Epub 2010 May 26.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
Homo sapiens H3 histone, family 3B (H3.3B), mRNA
NCBI Official Synonym Full Names
H3.3 histone B
NCBI Official Symbol
H3-3B
NCBI Official Synonym Symbols
H3-3A; H3.3B; H3F3B
NCBI Protein Information
histone H3.3

NCBI Description

Histones are basic nuclear proteins that are responsible for the nucleosome structure of the chromosomal fiber in eukaryotes. Two molecules of each of the four core histones (H2A, H2B, H3, and H4) form an octamer, around which approximately 146 bp of DNA is wrapped in repeating units, called nucleosomes. The linker histone, H1, interacts with linker DNA between nucleosomes and functions in the compaction of chromatin into higher order structures. This gene contains introns and its mRNA is polyadenylated, unlike most histone genes. The protein encoded by this gene is a replication-independent histone that is a member of the histone H3 family. Pseudogenes of this gene have been identified on the X chromosome, and on chromosomes 5, 13 and 17. [provided by RefSeq, Oct 2015]

Research Articles on H3F3B

Similar Products

Product Notes

The H3F3B (Catalog #AAA6152822) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The H3F3B (H3 Histone, Family 3B, H3.3B) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's H3F3B can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the H3F3B for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "H3F3B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.