Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GUCA1B Monoclonal Antibody | anti-GUCA1B antibody

GUCA1B (GCAP2, Guanylyl Cyclase-activating Protein 2, Guanylate Cyclase Activator 1B, DKFZp686E1183) (MaxLight 650)

Gene Names
GUCA1B; RP48; GCAP2; GUCA2; GCAP 2
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GUCA1B; Monoclonal Antibody; GUCA1B (GCAP2; Guanylyl Cyclase-activating Protein 2; Guanylate Cyclase Activator 1B; DKFZp686E1183) (MaxLight 650); anti-GUCA1B antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
5E7
Specificity
Recognizes human GUCA1B.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight650.
Applicable Applications for anti-GUCA1B antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa93-200 from human GUCA1B (NP_002089) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KLKWTFKIYDKDGNGCIDRLELLNIVEGIYQLKKACRRELQTEQDQLLTPEEVVDRIFLLVDENGDGQLSLNEFVEGARRDKWVMKMLQMDMNPSSWLAQQRRKSAMF
Conjugate
MaxLight650
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight650 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GUCA1B antibody
The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq].
Product Categories/Family for anti-GUCA1B antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
23kDa
NCBI Official Full Name
guanylyl cyclase-activating protein 2
NCBI Official Synonym Full Names
guanylate cyclase activator 1B
NCBI Official Symbol
GUCA1B
NCBI Official Synonym Symbols
RP48; GCAP2; GUCA2; GCAP 2
NCBI Protein Information
guanylyl cyclase-activating protein 2
UniProt Protein Name
Guanylyl cyclase-activating protein 2
UniProt Gene Name
GUCA1B
UniProt Synonym Gene Names
GCAP2; GCAP 2
UniProt Entry Name
GUC1B_HUMAN

NCBI Description

The protein encoded by this gene is a calcium-binding protein that activates photoreceptor guanylate cyclases. This gene may have arisen due to a gene duplication event since there is a highly similar gene clustered with it on chromosome 6. Mutations in this gene can cause a form of retinitis pigmentosa. [provided by RefSeq, Nov 2009]

Uniprot Description

GCAP2: Stimulates guanylyl cyclase 1 (GC1) and GC2 when free calcium ions concentration is low, and GC1 and GC2 when free calcium ions concentration is elevated. This Ca(2+)-sensitive regulation of GC is a key event in recovery of the dark state of rod photoreceptors following light exposure. Defects in GUCA1B are the cause of retinitis pigmentosa type 48 (RP48). RP48 is a retinal dystrophy belonging to the group of pigmentary retinopathies. Retinitis pigmentosa is characterized by retinal pigment deposits visible on fundus examination and primary loss of rod photoreceptor cells followed by secondary loss of cone photoreceptors. Patients typically have night vision blindness and loss of midperipheral visual field. As their condition progresses, they lose their far peripheral visual field and eventually central vision as well.

Protein type: Calcium-binding

Chromosomal Location of Human Ortholog: 6p21.1

Cellular Component: photoreceptor inner segment

Molecular Function: calcium sensitive guanylate cyclase activator activity; calcium ion binding

Biological Process: rhodopsin mediated signaling; phototransduction, visible light; regulation of rhodopsin mediated signaling; visual perception; cell-cell signaling; receptor guanylyl cyclase signaling pathway; positive regulation of guanylate cyclase activity; body fluid secretion

Disease: Retinitis Pigmentosa 48

Research Articles on GUCA1B

Similar Products

Product Notes

The GUCA1B guca1b (Catalog #AAA6222487) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GUCA1B (GCAP2, Guanylyl Cyclase-activating Protein 2, Guanylate Cyclase Activator 1B, DKFZp686E1183) (MaxLight 650) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GUCA1B can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GUCA1B guca1b for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GUCA1B, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.