Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GTSF1L expression in transfected 293T cell line by GTSF1L monoclonal antibody (M03), clone 5E7.Lane 1: GTSF1L transfected lysate (Predicted MW: 16.9 KDa).Lane 2: Non-transfected lysate.)

Mouse GTSF1L Monoclonal Antibody | anti-GTSF1L antibody

GTSF1L (Gametocyte Specific Factor 1-like, C20orf65, FAM112A, MGC50820, dJ1028D15.4) (FITC)

Applications
Western Blot
Purity
Purified
Synonyms
GTSF1L; Monoclonal Antibody; GTSF1L (Gametocyte Specific Factor 1-like; C20orf65; FAM112A; MGC50820; dJ1028D15.4) (FITC); Gametocyte Specific Factor 1-like; dJ1028D15.4; anti-GTSF1L antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
50000000
Specificity
Recognizes GTSF1L.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Sequence Length
148
Applicable Applications for anti-GTSF1L antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GTSF1L (NP_789761.1, 1aa-148aa) full-length recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
MEPEAFEICPYDPHHRIPLSRFQYHLASCRRKNPKKAKKMATCKYNACHVVPIKNLEEHEAVCVNRSAVEEEDTENPLKVSPPSSEQNDDTQQVSPCLPSPDIWNVDGANCQHVFVLKTFFPQKVVCENDTKESARETSPQKILRPGQ
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GTSF1L expression in transfected 293T cell line by GTSF1L monoclonal antibody (M03), clone 5E7.Lane 1: GTSF1L transfected lysate (Predicted MW: 16.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GTSF1L expression in transfected 293T cell line by GTSF1L monoclonal antibody (M03), clone 5E7.Lane 1: GTSF1L transfected lysate (Predicted MW: 16.9 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GTSF1L is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GTSF1L is 1 ng/ml as a capture antibody.)
Related Product Information for anti-GTSF1L antibody
Mouse monoclonal antibody raised against a full-length recombinant GTSF1L.
Product Categories/Family for anti-GTSF1L antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
gametocyte-specific factor 1-like isoform 1
UniProt Protein Name
Gametocyte-specific factor 1-like
UniProt Gene Name
GTSF1L
UniProt Synonym Gene Names
C20orf65; FAM112A
UniProt Entry Name
GTSFL_HUMAN

Similar Products

Product Notes

The GTSF1L gtsf1l (Catalog #AAA6178627) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GTSF1L can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTSF1L gtsf1l for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTSF1L, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.