Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GTF2IRD1 Monoclonal Antibody | anti-GTF2IRD1 antibody

GTF2IRD1 (General Transcription Factor II-I Repeat Domain-containing Protein 1, GTF2I Repeat Domain-containing Protein 1, General Transcription Factor III, MusTRD1/BEN, Muscle TFII-I Repeat Domain-containing Protein 1, Slow-muscle-fiber Enhancer-binding P

Gene Names
GTF2IRD1; BEN; WBS; GTF3; RBAP2; CREAM1; MUSTRD1; WBSCR11; WBSCR12; hMusTRD1alpha1
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GTF2IRD1; Monoclonal Antibody; GTF2IRD1 (General Transcription Factor II-I Repeat Domain-containing Protein 1; GTF2I Repeat Domain-containing Protein 1; General Transcription Factor III; MusTRD1/BEN; Muscle TFII-I Repeat Domain-containing Protein 1; Slow-muscle-fiber Enhancer-binding P; anti-GTF2IRD1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
1D2
Specificity
Recognizes human GTF2IRD1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
3284
Applicable Applications for anti-GTF2IRD1 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa431-530 from GTF2IRD1 (NP_005676) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
IFTGNKFTKDTTKLEPASPPEDTSAEVSRATVLDLAGNARSDKGSMSEDCGPGTSGELGGLRPIKIEPEDLDIIQVTVPDPSPTSEEMTDSMPGHLPSED
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(GTF2IRD1 monoclonal antibody Western Blot analysis of GTF2IRD1 expression in Jurkat)

Western Blot (WB) (GTF2IRD1 monoclonal antibody Western Blot analysis of GTF2IRD1 expression in Jurkat)

Western Blot (WB)

(Western Blot analysis of GTF2IRD1 expression in transfected 293T cell line by GTF2IRD1 monoclonal antibody Lane 1: GTF2IRD1 transfected lysate (106kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GTF2IRD1 expression in transfected 293T cell line by GTF2IRD1 monoclonal antibody Lane 1: GTF2IRD1 transfected lysate (106kD). Lane 2: Non-transfected lysate.)
Related Product Information for anti-GTF2IRD1 antibody
The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq].
Product Categories/Family for anti-GTF2IRD1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens GTF2I repeat domain containing 1 (GTF2IRD1), transcript variant 2, mRNA
NCBI Official Synonym Full Names
GTF2I repeat domain containing 1
NCBI Official Symbol
GTF2IRD1
NCBI Official Synonym Symbols
BEN; WBS; GTF3; RBAP2; CREAM1; MUSTRD1; WBSCR11; WBSCR12; hMusTRD1alpha1
NCBI Protein Information
general transcription factor II-I repeat domain-containing protein 1
UniProt Protein Name
General transcription factor II-I repeat domain-containing protein 1
UniProt Gene Name
GTF2IRD1
UniProt Synonym Gene Names
CREAM1; GTF3; MUSTRD1; RBAP2; WBSCR11; WBSCR12; GTF2I repeat domain-containing protein 1
UniProt Entry Name
GT2D1_HUMAN

NCBI Description

The protein encoded by this gene contains five GTF2I-like repeats and each repeat possesses a potential helix-loop-helix (HLH) motif. It may have the ability to interact with other HLH-proteins and function as a transcription factor or as a positive transcriptional regulator under the control of Retinoblastoma protein. This gene plays a role in craniofacial and cognitive development and mutations have been associated with Williams-Beuren syndrome, a multisystem developmental disorder caused by deletion of multiple genes at 7q11.23. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Nov 2010]

Uniprot Description

GTF2IRD1: May be a transcription regulator involved in cell-cycle progression and skeletal muscle differentiation. May repress GTF2I transcriptional functions, by preventing its nuclear residency, or by inhibiting its transcriptional activation. May contribute to slow-twitch fiber type specificity during myogenesis and in regenerating muscles. Binds troponin I slow-muscle fiber enhancer (USE B1). Binds specifically and with high affinity to the EFG sequences derived from the early enhancer of HOXC8. GTF2IRD1 is located in the Williams-Beuren syndrome (WBS) critical region. WBS results from a hemizygous deletion of several genes on chromosome 7q11.23, thought to arise as a consequence of unequal crossing over between highly homologous low-copy repeat sequences flanking the deleted region. Haploinsufficiency of GTF2IRD1 may be the cause of certain cardiovascular and musculo-skeletal abnormalities observed in the disease. Belongs to the TFII-I family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding

Chromosomal Location of Human Ortholog: 7q11.23

Cellular Component: nucleoplasm; cytoplasm; nucleus

Molecular Function: RNA polymerase II transcription factor activity, enhancer binding; DNA binding; transcription factor activity

Biological Process: regulation of transcription from RNA polymerase II promoter; transcription from RNA polymerase II promoter; regulation of transcription, DNA-dependent; multicellular organismal development; transition between slow and fast fiber

Disease: Williams-beuren Syndrome

Research Articles on GTF2IRD1

Similar Products

Product Notes

The GTF2IRD1 gtf2ird1 (Catalog #AAA6158108) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTF2IRD1 (General Transcription Factor II-I Repeat Domain-containing Protein 1, GTF2I Repeat Domain-containing Protein 1, General Transcription Factor III, MusTRD1/BEN, Muscle TFII-I Repeat Domain-containing Protein 1, Slow-muscle-fiber Enhancer-binding P reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2IRD1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTF2IRD1 gtf2ird1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTF2IRD1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.