Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (52.03kD).)

Mouse anti-Human GTF2I Monoclonal Antibody | anti-GTF2I antibody

GTF2I (BAP135, WBSCR6, General Transcription Factor II-I, Bruton Tyrosine Kinase-associated Protein 135, SRF-Phox1-interacting Protein, Williams-Beuren Syndrome Chromosomal Region 6 Protein) (HRP)

Gene Names
GTF2I; WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GTF2I; Monoclonal Antibody; GTF2I (BAP135; WBSCR6; General Transcription Factor II-I; Bruton Tyrosine Kinase-associated Protein 135; SRF-Phox1-interacting Protein; Williams-Beuren Syndrome Chromosomal Region 6 Protein) (HRP); anti-GTF2I antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3E2
Specificity
Recognizes human GTF2I.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GTF2I antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Full length recombinant corresponding to aa36-274 from human GTF2I (AAH04472.1) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
ELAKSKAEVACIAVYETDVFVVGTERGRAFVNTRKDFQKDFVKYCVEEEEKAAEMHKMKSTTQANRMSVDAVEIETLRKTVEDYFCFCYGKALGKSTVVPVPYEKMLRDQSAVVVQGLPEGVAFKHPENYDLATLKWILENKAGISFIIKRPFLEPKKHVGGRVMVTDADRSILSPGGSCGPIKVKTEPTEDSGISLEMAAVTVKEESEDPDYYQYNIQGSHHSSEGNEGTEMEVPAEG
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (52.03kD).)

Western Blot (WB) (Western Blot detection against Immunogen (52.03kD).)

Western Blot (WB)

(GTF2I monoclonal antibody. Western Blot analysis of GTF2I expression in human colon.)

Western Blot (WB) (GTF2I monoclonal antibody. Western Blot analysis of GTF2I expression in human colon.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GTF2I on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GTF2I on HeLa cell. [antibody concentration 10ug/ml])

Testing Data

(Detection limit for recombinant GST tagged GTF2I is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GTF2I is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-GTF2I antibody
References
1. An SNP in an ultraconserved regulatory element affects Dlx5/Dlx6 regulation in the forebrain. Poitras L, Yu M, Lesage-Pelletier C, Macdonald RB, Gagne JP, Hatch G, Kelly I, Hamilton SP, Rubenstein JL, Poirier GG, Ekker M.Development. 2010 Sep;137(18):3089-97. Epub 2010 Aug 11.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
30,409 Da
NCBI Official Full Name
Homo sapiens general transcription factor II, i, mRNA
NCBI Official Synonym Full Names
general transcription factor IIi
NCBI Official Symbol
GTF2I
NCBI Official Synonym Symbols
WBS; DIWS; SPIN; IB291; BAP135; BTKAP1; TFII-I; WBSCR6; GTFII-I
NCBI Protein Information
general transcription factor II-I; BTK-associated protein, 135kD; Bruton tyrosine kinase-associated protein 135; SRF-Phox1-interacting protein; Williams-Beuren syndrome chromosome region 6

NCBI Description

This gene encodes a phosphoprotein containing six characteristic repeat motifs. The encoded protein binds to the initiator element (Inr) and E-box element in promoters and functions as a regulator of transcription. This locus, along with several other neighboring genes, is deleted in Williams-Beuren syndrome. There are many closely related genes and pseudogenes for this gene on chromosome 7. This gene also has pseudogenes on chromosomes 9, 13, and 21. Alternatively spliced transcript variants encoding multiple isoforms have been observed. [provided by RefSeq, Jul 2013]

Research Articles on GTF2I

Similar Products

Product Notes

The GTF2I (Catalog #AAA6152804) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GTF2I (BAP135, WBSCR6, General Transcription Factor II-I, Bruton Tyrosine Kinase-associated Protein 135, SRF-Phox1-interacting Protein, Williams-Beuren Syndrome Chromosomal Region 6 Protein) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GTF2I can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GTF2I for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GTF2I, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.