Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse GRK6 Monoclonal Antibody | anti-GRK6 antibody

GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405)

Gene Names
GRK6; GPRK6
Reactivity
Human, Mouse, Rat
Applications
Western Blot
Purity
Purified
Synonyms
GRK6; Monoclonal Antibody; GRK6 (G Protein-coupled Receptor Kinase 6; FLJ32135; GPRK6) (MaxLight 405); anti-GRK6 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human, Mouse, Rat
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2G1
Specificity
Recognizes human GRK6. Species Crossreactivity: mouse and rat
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight405.
Sequence Length
589
Applicable Applications for anti-GRK6 antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa71-170 from human GRK6 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
CATRPELSRCVAFLDGVAEYEVTPDDKRKACGRQLTQ NFLSHTGPDLIPEVPRQLVTNCTQRLEQGPCKDLFQEL TRLTHEYLSVAPFADYLDSIYFNRF
Conjugate
MaxLight405
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight405 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GRK6 antibody
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene.
Product Categories/Family for anti-GRK6 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Official Full Name
G protein-coupled receptor kinase 6
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 6
NCBI Official Symbol
GRK6
NCBI Official Synonym Symbols
GPRK6
NCBI Protein Information
G protein-coupled receptor kinase 6

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating their deactivation. Several transcript variants encoding different isoforms have been described for this gene. [provided by RefSeq, Jul 2008]

Research Articles on GRK6

Similar Products

Product Notes

The GRK6 (Catalog #AAA6194144) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRK6 (G Protein-coupled Receptor Kinase 6, FLJ32135, GPRK6) (MaxLight 405) reacts with Human, Mouse, Rat and may cross-react with other species as described in the data sheet. AAA Biotech's GRK6 can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRK6 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRK6, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.