Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GRK4 Monoclonal Antibody | anti-GRK4 antibody

GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (PE)

Gene Names
GRK4; IT11; GPRK4; GRK4a; GPRK2L
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified
Synonyms
GRK4; Monoclonal Antibody; GRK4 (G Protein-Coupled Receptor Kinase 4; G Protein-Coupled Receptor Kinase 2-like; G-Protein Coupled Receptor Kinase 4; GPRK2L; GPRK4; GRK4a; IT11) (PE); anti-GRK4 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
4D2
Specificity
Recognizes human GRK4.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
578
Applicable Applications for anti-GRK4 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Recombinant protein corresponding to aa36-145 from human GRK4 with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LPPVSQCSELRHSIEKDYSSLCDKQPIGRRLFRQFCDT KPTLKRHIEFLDAVAEYEVADDEDRSDCGLSILDRFFN DKLAAPLPEIPPDVVTECRLGLKEENPSKKAFEE
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GRK4 antibody
This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension.
Product Categories/Family for anti-GRK4 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
G protein-coupled receptor kinase 4 isoform alpha
NCBI Official Synonym Full Names
G protein-coupled receptor kinase 4
NCBI Official Symbol
GRK4
NCBI Official Synonym Symbols
IT11; GPRK4; GRK4a; GPRK2L
NCBI Protein Information
G protein-coupled receptor kinase 4
UniProt Protein Name
G protein-coupled receptor kinase 4
UniProt Gene Name
GRK4
UniProt Synonym Gene Names
GPRK2L; GPRK4
UniProt Entry Name
GRK4_HUMAN

NCBI Description

This gene encodes a member of the guanine nucleotide-binding protein (G protein)-coupled receptor kinase subfamily of the Ser/Thr protein kinase family. The protein phosphorylates the activated forms of G protein-coupled receptors thus initiating its deactivation. This gene has been linked to both genetic and acquired hypertension. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Nov 2013]

Uniprot Description

GRK4: Specifically phosphorylates the activated forms of G protein-coupled receptors. GRK4-alpha can phosphorylate rhodopsin and its activity is inhibited by calmodulin; the other three isoforms do not phosphorylate rhodopsin and do not interact with calmodulin. GRK4-alpha and GRK4-gamma phosphorylate DRD3. Phosphorylates ADRB2. Belongs to the protein kinase superfamily. AGC Ser/Thr protein kinase family. GPRK subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Protein kinase, Ser/Thr (non-receptor); Protein kinase, AGC; EC 2.7.11.16; Kinase, protein; AGC group; GRK family; GRK subfamily

Chromosomal Location of Human Ortholog: 4p16.3

Cellular Component: cell soma; dendrite; cell cortex; cytosol

Molecular Function: G-protein coupled receptor kinase activity; rhodopsin kinase activity; ATP binding

Biological Process: G-protein coupled receptor internalization; receptor internalization; signal transduction; protein amino acid phosphorylation; regulation of G-protein coupled receptor protein signaling pathway

Research Articles on GRK4

Similar Products

Product Notes

The GRK4 grk4 (Catalog #AAA6161324) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRK4 (G Protein-Coupled Receptor Kinase 4, G Protein-Coupled Receptor Kinase 2-like, G-Protein Coupled Receptor Kinase 4, GPRK2L, GPRK4, GRK4a, IT11) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRK4 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRK4 grk4 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRK4, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.