Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GRIP1 is 0.1 ng/ml as a capture antibody.)

Mouse GRIP1 Monoclonal Antibody | anti-GRIP1 antibody

GRIP1 (Glutamate Receptor Interacting Protein 1, GRIP) (Biotin)

Gene Names
GRIP1; GRIP; FRASRS3
Applications
Western Blot
Purity
Purified
Synonyms
GRIP1; Monoclonal Antibody; GRIP1 (Glutamate Receptor Interacting Protein 1; GRIP) (Biotin); Glutamate Receptor Interacting Protein 1; GRIP; anti-GRIP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
4A9
Specificity
Recognizes GRIP1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GRIP1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GRIP1 (XP_290559, 851aa-950aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QSGILRELEATIMSGSTMSLNHEAPTPRSQLGRQASFQERSSSRPHYSQTTRSNTLPSDVGRKSVTLRKMKQEIKEIMSPTPVELHKVTLYKDSDMEDFG
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GRIP1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRIP1 is 0.1 ng/ml as a capture antibody.)

Western Blot (WB)

(GRIP1 monoclonal antibody (M05), clone 4A9. Western Blot analysis of GRIP1 expression in K-562.)

Western Blot (WB) (GRIP1 monoclonal antibody (M05), clone 4A9. Western Blot analysis of GRIP1 expression in K-562.)
Related Product Information for anti-GRIP1 antibody
Mouse monoclonal antibody raised against a partial recombinant GRIP1.
Product Categories/Family for anti-GRIP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
116,371 Da
NCBI Official Synonym Full Names
glutamate receptor interacting protein 1
NCBI Official Symbol
GRIP1
NCBI Official Synonym Symbols
GRIP; FRASRS3
NCBI Protein Information
glutamate receptor-interacting protein 1
UniProt Protein Name
Glutamate receptor-interacting protein 1
Protein Family
UniProt Gene Name
GRIP1
UniProt Synonym Gene Names
GRIP-1
UniProt Entry Name
GRIP1_HUMAN

NCBI Description

This gene encodes a member of the glutamate receptor interacting protein family. The encoded scaffold protein binds to and mediates the trafficking and membrane organization of a number of transmembrane proteins. Alternatively spliced transcript variants encoding different isoforms have been described. [provided by RefSeq, May 2010]

Uniprot Description

GRIP1: a scaffold protein for the assembly of a multiprotein signaling complex and as mediator of the trafficking of its binding partners at specific locations in neurons. Interacts with EphA7, EphB2, KIF5A, -B, -C, GluR2, -3, GRIPAP1, liprin A1, PPFIA4, FRAS1, and PTPRF.

Protein type: Adaptor/scaffold

Chromosomal Location of Human Ortholog: 12q14.3

Cellular Component: postsynaptic membrane; recycling endosome; neuron projection; endoplasmic reticulum; dendrite; cytoplasmic membrane-bound vesicle; plasma membrane; cytosol; cell junction; lipid raft

Molecular Function: protein C-terminus binding; protein binding; receptor signaling complex scaffold activity; androgen receptor binding; transcription coactivator activity; beta-catenin binding; glucocorticoid receptor binding

Biological Process: synaptic transmission; protein localization; positive regulation of transcription, DNA-dependent; androgen receptor signaling pathway; dendrite development

Disease: Fraser Syndrome

Research Articles on GRIP1

Similar Products

Product Notes

The GRIP1 grip1 (Catalog #AAA6174645) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GRIP1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRIP1 grip1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRIP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.