Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GRID1 is 0.1 ng/ml as a capture antibody.)

Mouse GRID1 Monoclonal Antibody | anti-GRID1 antibody

GRID1 (Glutamate Receptor, Ionotropic, delta 1, KIAA1220) (APC)

Gene Names
GRID1; GluD1
Applications
Western Blot
Purity
Purified
Synonyms
GRID1; Monoclonal Antibody; GRID1 (Glutamate Receptor; Ionotropic; delta 1; KIAA1220) (APC); Glutamate Receptor; KIAA1220; anti-GRID1 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2b,k
Clone Number
3A8
Specificity
Recognizes GRID1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Sequence Length
1009
Applicable Applications for anti-GRID1 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GRID1 (NP_060021, 349aa-441aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
LNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFREDSSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKV
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GRID1 is 0.1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GRID1 is 0.1 ng/ml as a capture antibody.)
Related Product Information for anti-GRID1 antibody
This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.
Product Categories/Family for anti-GRID1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
glutamate receptor ionotropic, delta-1
NCBI Official Synonym Full Names
glutamate ionotropic receptor delta type subunit 1
NCBI Official Symbol
GRID1
NCBI Official Synonym Symbols
GluD1
NCBI Protein Information
glutamate receptor ionotropic, delta-1
UniProt Protein Name
Glutamate receptor ionotropic, delta-1
UniProt Gene Name
GRID1
UniProt Synonym Gene Names
KIAA1220; GluD1
UniProt Entry Name
GRID1_HUMAN

NCBI Description

This gene encodes a subunit of glutamate receptor channels. These channels mediate most of the fast excitatory synaptic transmission in the central nervous system and play key roles in synaptic plasticity.[provided by RefSeq, Jan 2009]

Uniprot Description

GluR-delta1: Receptor for glutamate. L-glutamate acts as an excitatory neurotransmitter at many synapses in the central nervous system. The postsynaptic actions of Glu are mediated by a variety of receptors that are named according to their selective agonists. Belongs to the glutamate-gated ion channel (TC 1.A.10.1) family. GRID1 subfamily.

Protein type: Channel, calcium; Membrane protein, integral; Channel, ligand-gated; Membrane protein, multi-pass; Receptor, misc.

Chromosomal Location of Human Ortholog: 10q22

Cellular Component: postsynaptic membrane; dendrite; ionotropic glutamate receptor complex; cell junction

Molecular Function: extracellular-glutamate-gated ion channel activity; ionotropic glutamate receptor activity

Biological Process: synaptic transmission, glutamatergic; ionotropic glutamate receptor signaling pathway; social behavior

Research Articles on GRID1

Similar Products

Product Notes

The GRID1 grid1 (Catalog #AAA6169491) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GRID1 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRID1 grid1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRID1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.