Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Mouse anti-Human GRB7 Monoclonal Antibody | anti-GRB7 antibody

GRB7 (Growth Factor Receptor-bound Protein 7, B47, Epidermal Growth Factor Receptor GRB-7, GRB7 Adapter Protein) (AP)

Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GRB7; Monoclonal Antibody; GRB7 (Growth Factor Receptor-bound Protein 7; B47; Epidermal Growth Factor Receptor GRB-7; GRB7 Adapter Protein) (AP); anti-GRB7 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2b, lambda
Clone Number
3C12
Specificity
Recognizes human GRB7.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).
Applicable Applications for anti-GRB7 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa37-136 from human GRB7 (AAH06535) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EEVKRSQPLLIPTTGRKLREEERRATSLPSIPNPFPELCSPPSQSPILGGPSSARGLLPRDASRPHVVKVYSEDGACRSVEVAAGATARHVCEMLVQRAH
Conjugate
AP
Preparation and Storage
Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB) (Western Blot detection against Immunogen (36.74kD).)

Western Blot (WB)

(Western Blot analysis of GRB7 expression in transfected 293T cell line by GRB7 monoclonal antibody. Lane 1: GRB7 transfected lysate (59.7kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GRB7 expression in transfected 293T cell line by GRB7 monoclonal antibody. Lane 1: GRB7 transfected lysate (59.7kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of GRB7 transfected lysate using GRB7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRB7 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GRB7 transfected lysate using GRB7 monoclonal antibody and Protein A Magnetic Bead, and immunoblotted with GRB7 rabbit polyclonal antibody.)
Related Product Information for anti-GRB7 antibody
The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Alternative splicing results in multiple transcript variants encoding different isoforms, although the full-length natures of only two of the variants have been determined to date.
Product Categories/Family for anti-GRB7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
Molecular Weight
55,920 Da
NCBI Official Full Name
Homo sapiens growth factor receptor-bound protein 7, mRNA
NCBI Official Synonym Full Names
growth factor receptor bound protein 7
NCBI Official Symbol
GRB7
NCBI Protein Information
growth factor receptor-bound protein 7

NCBI Description

The product of this gene belongs to a small family of adapter proteins that are known to interact with a number of receptor tyrosine kinases and signaling molecules. This gene encodes a growth factor receptor-binding protein that interacts with epidermal growth factor receptor (EGFR) and ephrin receptors. The protein plays a role in the integrin signaling pathway and cell migration by binding with focal adhesion kinase (FAK). Several transcript variants encoding two different isoforms have been found for this gene. [provided by RefSeq, Jun 2011]

Research Articles on GRB7

Similar Products

Product Notes

The GRB7 (Catalog #AAA6131551) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GRB7 (Growth Factor Receptor-bound Protein 7, B47, Epidermal Growth Factor Receptor GRB-7, GRB7 Adapter Protein) (AP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GRB7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GRB7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GRB7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.