Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of GPT2 expression in transfected 293T cell line by GPT2 monoclonal antibody (M04), clone 7A11.Lane 1: GPT2 transfected lysate (Predicted MW: 57.9 KDa).Lane 2: Non-transfected lysate.)

Mouse GPT2 Monoclonal Antibody | anti-GPT2 antibody

GPT2 (Glutamic Pyruvate Transaminase (alanine Aminotransferase) 2, ALT2) (Biotin)

Gene Names
GPT2; ALT2; GPT 2; MRT49
Applications
Immunofluorescence, Western Blot
Purity
Purified
Synonyms
GPT2; Monoclonal Antibody; GPT2 (Glutamic Pyruvate Transaminase (alanine Aminotransferase) 2; ALT2) (Biotin); Glutamic Pyruvate Transaminase (alanine Aminotransferase) 2; ALT2; anti-GPT2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
7A11
Specificity
Recognizes GPT2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Biotin.
Applicable Applications for anti-GPT2 antibody
Immunofluorescence (IF), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GPT2 (NP_597700, 358aa-456aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
NLHPEIKGQLVKLLSVRLCPPVSGQAAMDIVVNPPVAGEESFEQFSREKESVLGNLAKKAKLTEDLFNQVPGIHCNPLQGAMYAFPRIFIPAKAVEAAQ
Conjugate
Biotin
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of GPT2 expression in transfected 293T cell line by GPT2 monoclonal antibody (M04), clone 7A11.Lane 1: GPT2 transfected lysate (Predicted MW: 57.9 KDa).Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GPT2 expression in transfected 293T cell line by GPT2 monoclonal antibody (M04), clone 7A11.Lane 1: GPT2 transfected lysate (Predicted MW: 57.9 KDa).Lane 2: Non-transfected lysate.)

Testing Data

(Detection limit for recombinant GST tagged GPT2 is 1 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GPT2 is 1 ng/ml as a capture antibody.)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GPT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GPT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GPT2 on HeLa cell. [antibody concentration 10 ug/ml])

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GPT2 on HeLa cell. [antibody concentration 10 ug/ml])
Related Product Information for anti-GPT2 antibody
GPT (MIM 138200) and GPT2 (EC 2.6.1.2), also known as alanine transaminases, are pyridoxal enzymes that catalyze the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. By mediating the conversion of these 4 major intermediate metabolites, these transaminases have roles in gluconeogenesis and in amino acid metabolism. [supplied by OMIM]
Product Categories/Family for anti-GPT2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
60.3kDa (546aa)
NCBI Official Full Name
alanine aminotransferase 2 isoform 1
NCBI Official Synonym Full Names
glutamic--pyruvic transaminase 2
NCBI Official Symbol
GPT2
NCBI Official Synonym Symbols
ALT2; GPT 2; MRT49
NCBI Protein Information
alanine aminotransferase 2
UniProt Protein Name
Alanine aminotransferase 2
UniProt Gene Name
GPT2
UniProt Synonym Gene Names
AAT2; ALT2; ALT2; GPT 2
UniProt Entry Name
ALAT2_HUMAN

NCBI Description

This gene encodes a mitochondrial alanine transaminase, a pyridoxal enzyme that catalyzes the reversible transamination between alanine and 2-oxoglutarate to generate pyruvate and glutamate. Alanine transaminases play roles in gluconeogenesis and amino acid metabolism in many tissues including skeletal muscle, kidney, and liver. Activating transcription factor 4 upregulates this gene under metabolic stress conditions in hepatocyte cell lines. A loss of function mutation in this gene has been associated with developmental encephalopathy. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Apr 2015]

Uniprot Description

GPT2: Catalyzes the reversible transamination between alanine and 2-oxoglutarate to form pyruvate and glutamate. Belongs to the class-I pyridoxal-phosphate-dependent aminotransferase family. Alanine aminotransferase subfamily. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Mitochondrial; EC 2.6.1.2; Amino Acid Metabolism - alanine, aspartate and glutamate; Transferase

Chromosomal Location of Human Ortholog: 16q12.1

Cellular Component: mitochondrial matrix

Molecular Function: alanine transaminase activity; pyridoxal phosphate binding

Biological Process: amino acid biosynthetic process; L-alanine metabolic process; 2-oxoglutarate metabolic process; L-alanine catabolic process

Disease: Mental Retardation, Autosomal Recessive 49

Research Articles on GPT2

Similar Products

Product Notes

The GPT2 gpt2 (Catalog #AAA6174257) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GPT2 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GPT2 gpt2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GPT2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.