Mouse anti-Human GOLGA7 Monoclonal Antibody | anti-GOLGA7 antibody

GOLGA7 (Golgin Subfamily A Member 7, Golgin A7, GOLGA7A, GOLGA3AP1, Golgi Complex-associated Protein of 16kD, GCP16, HDCKB03P, HSPC041, MGC4876, MGC21096)

Cat. Num. AAA6004519

• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Affinity Purified; Purified by Protein A affinity chromatography.
• Synonyms: GOLGA7; Monoclonal Antibody; GOLGA7 (Golgin Subfamily A Member 7; Golgin A7; GOLGA7A; GOLGA3AP1; Golgi Complex-associated Protein of 16kD; GCP16; HDCKB03P; HSPC041; MGC4876; MGC21096); Anti -GOLGA7 (Golgin Subfamily A Member 7; anti-GOLGA7 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 2H8
• Specificity: Recognizes human GOLGA7.
• Purity/Purification: Affinity Purified; Purified by Protein A affinity chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2.
• Sequence: MRPQQAPVSGKVFIQRDYSSGTRCQFQTKFPAELENRIDRQQFEETVRTLNNLYAEAEKLGGQSYLEGCLACLTAYTIFLCMETHYEKVLKKVSKYIQEQNEKIYAPQGLLLTDPIERGLRVIEITIYEDRGMSSGR

• Applicable Applications for anti-GOLGA7 antibody: ELISA (EL/EIA), Western Blot (WB)
• Application Notes: Suitable for use in ELISA and Western Blot.
• Immunogen: Full length recombinant corresponding to aa1-138 from human GOLGA7 (AAH12032) with GST tag. MW of the GST tag alone is 26kD.
• Preparation and Storage: May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (41.18kD).)

Western Blot (WB)

(GOLGA7 monoclonal antibody, Western Blot analysis of GOLGA7 expression in HL-60.)

Immunoprecipitation (IP)

(Immunoprecipitation of GOLGA7 transfected lysate using GOLGA7 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GOLGA7 monoclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged GOLGA7 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-GOLGA7 antibody

The Golgi apparatus, which participates in glycosylation and transport of proteins and lipids in the secretory pathway, consists of a series of stacked cisternae (flattened membrane sacs). Interactions between the Golgi and microtubules are thought to be important for the reorganization of the Golgi after it fragments during mitosis. This gene encodes one of the golgins, a family of proteins localized to the Golgi. This encoded protein is associated with Sjogren's syndrome.

Product Categories/Family for anti-GOLGA7 antibody

Antibodies; Abs to Golgi Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 78365295
• NCBI GeneID: 616809
• NCBI Accession #: NP_001030561.1
• NCBI GenBank Nucleotide #: NM_001035484.1
• UniProt Accession #: Q5EA55; Q0VCT8
• Molecular Weight: 15,824 Da
• NCBI Official Full Name: Golgin subfamily A member 7
• NCBI Official Synonym Full Names: golgin A7<
• NCBI Official Symbol: GOLGA7
• NCBI Protein Information: Golgin subfamily A member 7; golgi autoantigen, golgin subfamily a, 7
• UniProt Protein Name: Golgin subfamily A member 7
• Protein Family: Golgin subfamily
• UniProt Gene Name: GOLGA7
• UniProt Entry Name: GOGA7_BOVIN

Uniprot Description

Function: May be involved in protein transport from Golgi to cell surface. The ZDHHC9-GOLGA7 complex is a palmitoyltransferase specific for HRAS and NRAS

By similarity.

Subunit structure: Interacts with GOLGA3. Interacts with ZDHHC9

By similarity.

Subcellular location: Golgi apparatus membrane; Lipid-anchor

By similarity.

Post-translational modification: Palmitoylated on Cys-69 and Cys-72; which is required for Golgi localization and interaction with GOLGA3

By similarity.

Sequence similarities: Belongs to the ERF4 family.