Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged GNRHR2 is 0.03 ng/ml as a capture antibody.)

Mouse GNRHR2 Monoclonal Antibody | anti-GNRHR2 antibody

GNRHR2 (Gonadotropin-releasing Hormone (Type 2) Receptor 2, GnRH-II-R) (FITC)

Gene Names
FZD2; Fz2; fz-2; fzE2; hFz2; OMOD2
Applications
Western Blot
Purity
Purified
Synonyms
GNRHR2; Monoclonal Antibody; GNRHR2 (Gonadotropin-releasing Hormone (Type 2) Receptor 2; GnRH-II-R) (FITC); Gonadotropin-releasing Hormone (Type 2) Receptor 2; GnRH-II-R; anti-GNRHR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
1A5
Specificity
Recognizes GNRHR2.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-GNRHR2 antibody
Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GNRHR2 (NP_001457, 237aa-292aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
TLGCRRGHQELSIDSSKEGSGRMLQEEIHAFRQLEVQKTVTSRRAGETKGISITSI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer.

FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged GNRHR2 is 0.03 ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GNRHR2 is 0.03 ng/ml as a capture antibody.)
Related Product Information for anti-GNRHR2 antibody
The receptor for gonadotropin releasing hormone 2 (GnRH2) is encoded by the GnRH2 receptor (GnRHR2) gene. In non-hominoid primates and non-mammalian vertebrates, GnRHR2 encodes a seven-transmembrane G-protein coupled receptor. However, in human, the N-terminus of the predicted protein contains a frameshift and premature stop codon. In human, GnRHR2 transcription occurs but whether the gene produces a functional C-terminal multi-transmembrane protein is currently unresolved. Alternative splice variants have been reported. An untranscribed pseudogene of GnRHR2 is also on chromosome 14. [provided by RefSeq]
Product Categories/Family for anti-GNRHR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
63kDa
NCBI Official Full Name
frizzled-2
NCBI Official Synonym Full Names
frizzled class receptor 2
NCBI Official Symbol
FZD2
NCBI Official Synonym Symbols
Fz2; fz-2; fzE2; hFz2; OMOD2
NCBI Protein Information
frizzled-2
UniProt Protein Name
Frizzled-2
UniProt Gene Name
FZD2
UniProt Synonym Gene Names
Fz-2; hFz2
UniProt Entry Name
FZD2_HUMAN

NCBI Description

This intronless gene is a member of the frizzled gene family. Members of this family encode seven-transmembrane domain proteins that are receptors for the wingless type MMTV integration site family of signaling proteins. This gene encodes a protein that is coupled to the beta-catenin canonical signaling pathway. Competition between the wingless-type MMTV integration site family, member 3A and wingless-type MMTV integration site family, member 5A gene products for binding of this protein is thought to regulate the beta-catenin-dependent and -independent pathways. [provided by RefSeq, Dec 2010]

Uniprot Description

FZD2: Receptor for Wnt proteins. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK- 3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. Belongs to the G-protein coupled receptor Fz/Smo family.

Protein type: Membrane protein, integral; Motility/polarity/chemotaxis; Receptor, GPCR; GPCR, Fz/Smo family; Membrane protein, multi-pass

Chromosomal Location of Human Ortholog: 17q21.1

Cellular Component: focal adhesion; cytoplasm; integral to membrane; plasma membrane

Molecular Function: G-protein coupled receptor activity; Wnt-protein binding; Wnt receptor activity; PDZ domain binding

Biological Process: neuron differentiation; G-protein coupled receptor protein signaling pathway; cell-cell signaling; epithelial cell differentiation; inner ear receptor cell development; positive regulation of transcription, DNA-dependent; sensory perception of smell; hard palate development; positive regulation of transcription factor activity; Wnt receptor signaling pathway through beta-catenin; positive regulation of cGMP metabolic process

Research Articles on GNRHR2

Similar Products

Product Notes

The GNRHR2 fzd2 (Catalog #AAA6178448) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GNRHR2 can be used in a range of immunoassay formats including, but not limited to, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GNRHR2 fzd2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GNRHR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.