Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human GMPPA Monoclonal Antibody | anti-GMPPA antibody

GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha)

Reactivity
Human
Applications
ELISA, Western Blot
Purity
Affinity Purified
Purified by Protein A affinity chromatography.
Synonyms
GMPPA; Monoclonal Antibody; GMPPA (Mannose-1-phosphate Guanyltransferase alpha; GDP-mannose Pyrophosphorylase A; GTP-mannose-1-phosphate Guanylyltransferase alpha); Anti -GMPPA (Mannose-1-phosphate Guanyltransferase alpha; anti-GMPPA antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
2F1
Specificity
Recognizes human GMPPA.
Purity/Purification
Affinity Purified
Purified by Protein A affinity chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2.
Sequence
ESIVLHGATLQEHTCVLHSIVGWGSTVGRWARVEGTPSDPNPNDPRARMDSESLFKDGKLLPAITILGCRVRIPAEVLILNSIVLPHKELSRSFTNQIIL*
Applicable Applications for anti-GMPPA antibody
ELISA (EL/EIA), Western Blot (WB)
Application Notes
Suitable for use in ELISA and Western Blot.
Immunogen
Partial recombinant corresponding to aa321-421 from human GMPPA (NP_037467) with GST tag. MW of the GST tag alone is 26kD.
Preparation and Storage
May be stored at 4 degree C for short-term only. Aliquot to avoid repeated freezing and thawing. Store at -20 degree C. Aliquots are stable for at least 12 months. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody.|Lane 1: GMPPA transfected lysate (46.291kD).|Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of GMPPA expression in transfected 293T cell line by GMPPA monoclonal antibody.|Lane 1: GMPPA transfected lysate (46.291kD).|Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of GMPPA transfected lysate using GMPPA monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GMPPA monoclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of GMPPA transfected lysate using GMPPA monoclonal antibody and Protein A Magnetic Bead and immunoblotted with GMPPA monoclonal antibody.)
Related Product Information for anti-GMPPA antibody
GTP + alpha-D-mannose 1-phosphate = diphosphate + GDP-mannose.
Product Categories/Family for anti-GMPPA antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
UniProt Accession #
Molecular Weight
46,291 Da
NCBI Official Full Name
GDP-mannose pyrophosphorylase A
NCBI Official Synonym Full Names
GDP-mannose pyrophosphorylase A
NCBI Official Symbol
GMPPA
NCBI Protein Information
mannose-1-phosphate guanyltransferase alpha; mannose-1-phosphate guanylyltransferase (GDP); GTP-mannose-1-phosphate guanylyltransferase alpha
UniProt Protein Name
Mannose-1-phosphate guanyltransferase alpha
UniProt Gene Name
GMPPA
UniProt Entry Name
GMPPA_HUMAN

NCBI Description

This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]

Uniprot Description

GMPPA: This gene is thought to encode a GDP-mannose pyrophosphorylase. This enzyme catalyzes the reaction which converts mannose-1-phosphate and GTP to GDP-mannose which is involved in the production of N-linked oligosaccharides. [provided by RefSeq, Jul 2008]

Protein type: Carbohydrate Metabolism - amino sugar and nucleotide sugar; EC 2.7.7.13; Transferase; Carbohydrate Metabolism - fructose and mannose

Chromosomal Location of Human Ortholog: 2q35

Cellular Component: cytoplasm

Molecular Function: nucleotidyltransferase activity

Biological Process: cellular protein metabolic process; dolichol-linked oligosaccharide biosynthetic process; GDP-mannose biosynthetic process; protein amino acid N-linked glycosylation via asparagine; post-translational protein modification

Disease: Alacrima, Achalasia, And Mental Retardation Syndrome

Similar Products

Product Notes

The GMPPA gmppa (Catalog #AAA6007613) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GMPPA (Mannose-1-phosphate Guanyltransferase alpha, GDP-mannose Pyrophosphorylase A, GTP-mannose-1-phosphate Guanylyltransferase alpha) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GMPPA can be used in a range of immunoassay formats including, but not limited to, ELISA (EL/EIA), Western Blot (WB). Suitable for use in ELISA and Western Blot. Researchers should empirically determine the suitability of the GMPPA gmppa for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. The amino acid sequence is listed below: ESIVLHGATL QEHTCVLHSI VGWGSTVGRW ARVEGTPSDP NPNDPRARMD SESLFKDGKL LPAITILGCR VRIPAEVLIL NSIVLPHKEL SRSFTNQIIL *. It is sometimes possible for the material contained within the vial of "GMPPA, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.