Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Mouse anti-Human GLYAT Monoclonal Antibody | anti-GLYAT antibody

GLYAT (ACGNAT, CAT, GAT, Glycine N-acyltransferase, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, Benzoyl-coenzyme A:glycine N-acyltransferase, Glycine N-benzoyltransferase, HRP-1(CL

Gene Names
GLYAT; CAT; GAT; ACGNAT
Reactivity
Human
Applications
ELISA, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLYAT; Monoclonal Antibody; GLYAT (ACGNAT; CAT; GAT; Glycine N-acyltransferase; Acyl-CoA:glycine N-acyltransferase; Aralkyl acyl-CoA N-acyltransferase; Aralkyl acyl-CoA:amino acid N-acyltransferase; Benzoyl-coenzyme A:glycine N-acyltransferase; Glycine N-benzoyltransferase; HRP-1(CL; anti-GLYAT antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A10
Specificity
Recognizes human GLYAT.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Sequence Length
2024
Applicable Applications for anti-GLYAT antibody
ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB)
Application Notes
IHC-P: 3ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa64-163 from GLYAT (NP_964011) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
DMTDDLDHYTNTYQIYSKDPQNCQEFLGSPELINWKQHLQIQSSQPSLNEAIQNLAAIKSFKVKQTQRILYMAAETAKELTPFLLKSKILSPSGGKPKAI
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB) (Western Blot detection against Immunogen (37.11kD).)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to GLYAT on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to GLYAT on formalin-fixed paraffin-embedded human salivary gland. [antibody concentration 3ug/ml])

Testing Data

(Detection limit for recombinant GST tagged GLYAT is 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GLYAT is 0.1ng/ml as a capture antibody.)
Product Categories/Family for anti-GLYAT antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
NCBI Official Full Name
Homo sapiens glycine-N-acyltransferase (GLYAT), transcript variant 1, mRNA
NCBI Official Synonym Full Names
glycine-N-acyltransferase
NCBI Official Symbol
GLYAT
NCBI Official Synonym Symbols
CAT; GAT; ACGNAT
NCBI Protein Information
glycine N-acyltransferase
UniProt Protein Name
Glycine N-acyltransferase
Protein Family
UniProt Gene Name
GLYAT
UniProt Synonym Gene Names
ACGNAT; CAT; GAT; AAc
UniProt Entry Name
GLYAT_HUMAN

NCBI Description

The glycine-N-acyltransferase protein conjugates glycine with acyl-CoA substrates in the mitochondria. The protein is thought to be important in the detoxification of endogenous and xenobiotic acyl-CoA's. Two transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2008]

Uniprot Description

GLYAT: Mitochondrial acyltransferase which transfers an acyl group to the N-terminus of glycine and glutamine, although much less efficiently. Can conjugate numerous substrates to form a variety of N-acylglycines, with a preference for benzoyl-CoA over phenylacetyl-CoA as acyl donors. Thereby detoxify xenobiotics, such as benzoic acid or salicylic acid, and endogenous organic acids, such as isovaleric acid. Belongs to the glycine N-acyltransferase family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: EC 2.3.1.13; Mitochondrial; EC 2.3.1.71; Transferase

Chromosomal Location of Human Ortholog: 11q12.1

Cellular Component: mitochondrion; mitochondrial matrix

Molecular Function: glycine N-benzoyltransferase activity; glycine N-acyltransferase activity; transferase activity, transferring acyl groups

Biological Process: glycine metabolic process; acyl-CoA metabolic process; response to toxin; xenobiotic metabolic process; monocarboxylic acid metabolic process

Research Articles on GLYAT

Similar Products

Product Notes

The GLYAT glyat (Catalog #AAA6158005) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLYAT (ACGNAT, CAT, GAT, Glycine N-acyltransferase, Acyl-CoA:glycine N-acyltransferase, Aralkyl acyl-CoA N-acyltransferase, Aralkyl acyl-CoA:amino acid N-acyltransferase, Benzoyl-coenzyme A:glycine N-acyltransferase, Glycine N-benzoyltransferase, HRP-1(CL reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLYAT can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunohistochemistry (IHC) Paraffin, Western Blot (WB). IHC-P: 3ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLYAT glyat for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLYAT, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.