Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Mouse anti-Human Glutaminase Monoclonal Antibody | anti-GLS antibody

Glutaminase, Kidney Isoform, Mitochondrial (GLS, GLS1, AAD20, DKFZp686O15119, FLJ10358, K-glutaminase, KIAA0838, L-glutamine Amidohydrolase) APC

Gene Names
GLS; GAC; GAM; KGA; GLS1; AAD20
Reactivity
Human
Applications
ELISA, Immunofluorescence, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
Glutaminase; Monoclonal Antibody; Kidney Isoform; Mitochondrial (GLS; GLS1; AAD20; DKFZp686O15119; FLJ10358; K-glutaminase; KIAA0838; L-glutamine Amidohydrolase) APC; anti-GLS antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
5C4
Specificity
Recognizes human GLS.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Allophycocyanin (APC).
Applicable Applications for anti-GLS antibody
ELISA (EIA), Immunofluorescence (IF), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa580-669 from human GLS (NP_055720) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
EQRDYDSRTALHVAAAEGHVEVVKFLLEACKVNPFPKDRWNNTPMDEALHFGHHDVFKILQEYQVQYTPQGDSDNGKENQTVHKNLDGLL
Conjugate
APC
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: APC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (35.64kD).)

Western Blot (WB) (Western Blot detection against Immunogen (35.64kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GLS on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GLS on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GLS is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GLS is ~0.3ng/ml as a capture antibody.)
Product Categories/Family for anti-GLS antibody
References
1. Mitochondrial localization and structure-based phosphate activation mechanism of Glutaminase C with implications for cancer metabolism. Cassago A, Ferreira AP, Ferreira IM, Fornezari C, Gomes ER, Greene KS, Pereira HM, Garratt RC, Dias SM, Ambrosio AL.Proc Natl Acad Sci U S A. 2012 Jan 24;109(4):1092-7. Epub 2012 Jan 6. 2. Premature senescence of human endothelial cells induced by inhibition of glutaminase. Unterluggauer H, Mazurek S, Lener B, Hutter E, Eigenbrodt E, Zwerschke W, Jansen-Durr P.Biogerontology. 2008 Aug;9(4):247-59. Epub 2008 Mar 4.

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
73kDa
NCBI Official Full Name
glutaminase kidney isoform, mitochondrial isoform 1
NCBI Official Synonym Full Names
glutaminase
NCBI Official Symbol
GLS
NCBI Official Synonym Symbols
GAC; GAM; KGA; GLS1; AAD20
NCBI Protein Information
glutaminase kidney isoform, mitochondrial
UniProt Protein Name
Glutaminase kidney isoform, mitochondrial
Protein Family
UniProt Gene Name
GLS
UniProt Synonym Gene Names
GLS1; KIAA0838; GLS
UniProt Entry Name
GLSK_HUMAN

NCBI Description

This gene encodes the K-type mitochondrial glutaminase. The encoded protein is an phosphate-activated amidohydrolase that catalyzes the hydrolysis of glutamine to glutamate and ammonia. This protein is primarily expressed in the brain and kidney plays an essential role in generating energy for metabolism, synthesizing the brain neurotransmitter glutamate and maintaining acid-base balance in the kidney. Alternate splicing results in multiple transcript variants. [provided by RefSeq, Jan 2012]

Uniprot Description

glutaminase: Catalyzes the first reaction in the primary pathway for the renal catabolism of glutamine. Plays a role in maintaining acid-base homeostasis. Regulates the levels of the neurotransmitter glutamate in the brain. Isoform 2 lacks catalytic activity. Belongs to the glutaminase family. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: Amino Acid Metabolism - arginine and proline; Hydrolase; Mitochondrial; Amino Acid Metabolism - alanine, aspartate and glutamate; Other Amino Acids Metabolism - D-Glutamine and D-glutamate; Energy Metabolism - nitrogen; EC 3.5.1.2

Chromosomal Location of Human Ortholog: 2q32-q34

Cellular Component: mitochondrion; mitochondrial matrix; cytosol

Molecular Function: protein binding; glutaminase activity

Biological Process: synaptic transmission; glutamate secretion; suckling behavior; neurotransmitter secretion; glutamine catabolic process; neurological control of breathing; glutamate biosynthetic process; amino acid biosynthetic process; protein homotetramerization

Research Articles on GLS

Similar Products

Product Notes

The GLS gls (Catalog #AAA6136790) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The Glutaminase, Kidney Isoform, Mitochondrial (GLS, GLS1, AAD20, DKFZp686O15119, FLJ10358, K-glutaminase, KIAA0838, L-glutamine Amidohydrolase) APC reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's Glutaminase can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLS gls for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "Glutaminase, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.