Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Mouse anti-Human GLTSCR2 Monoclonal Antibody | anti-GLTSCR2 antibody

GLTSCR2 (Glioma Tumor Suppressor Candidate Region Gene 2 Protein, p60, PICT-1, PICT1) (HRP)

Gene Names
NOP53; PICT1; PICT-1; GLTSCR2
Reactivity
Human
Applications
ELISA, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GLTSCR2; Monoclonal Antibody; GLTSCR2 (Glioma Tumor Suppressor Candidate Region Gene 2 Protein; p60; PICT-1; PICT1) (HRP); anti-GLTSCR2 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
5A8
Specificity
Recognizes human GLTSCR2.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GLTSCR2 antibody
ELISA (EIA), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa402-479 from human GLTSCR2 (NP_056525) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
KPRRLGRLKYQAPDIDVQLSSELTDSLRTLKPEGNILRDRFKSFQRRNMIEPRERAKFKRKYKVKLVEKRAFREIQL
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.58kD).)

Western Blot (WB) (Western Blot detection against Immunogen (34.58kD).)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to GLTSCR2 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to GLTSCR2 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged GLTSCR2 is ~0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged GLTSCR2 is ~0.1ng/ml as a capture antibody.)
Related Product Information for anti-GLTSCR2 antibody
Interacts with HSV-1 early proteins ICP22 and ICP0.
Product Categories/Family for anti-GLTSCR2 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
54kDa
NCBI Official Full Name
ribosome biogenesis protein NOP53
NCBI Official Synonym Full Names
NOP53 ribosome biogenesis factor
NCBI Official Symbol
NOP53
NCBI Official Synonym Symbols
PICT1; PICT-1; GLTSCR2
NCBI Protein Information
ribosome biogenesis protein NOP53
UniProt Protein Name
Glioma tumor suppressor candidate region gene 2 protein
UniProt Gene Name
GLTSCR2
UniProt Entry Name
GSCR2_HUMAN

Uniprot Description

Subunit structure: Interacts with HSV-1 early proteins ICP22 and ICP0.

Subcellular location: Nucleus › nucleolus Ref.3 Ref.6.

Tissue specificity: Expressed at high levels in heart and pancreas, moderate levels in placenta, liver, skeletal muscle, and kidney, and low levels in brain and lung. Ref.1

Sequence similarities: Belongs to the GLTSCR2 family.

Research Articles on GLTSCR2

Similar Products

Product Notes

The GLTSCR2 gltscr2 (Catalog #AAA6152695) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GLTSCR2 (Glioma Tumor Suppressor Candidate Region Gene 2 Protein, p60, PICT-1, PICT1) (HRP) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GLTSCR2 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GLTSCR2 gltscr2 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GLTSCR2, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.