Mouse anti-Human GLE1 Monoclonal Antibody | anti-GLE1 antibody

GLE1 (Nucleoporin GLE1, hGLE1, GLE1-like Protein, GLE1L) (FITC)

Cat. Num. AAA6147384

• Gene Names: GLE1; LCCS; GLE1L; LCCS1; hGLE1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GLE1; Monoclonal Antibody; GLE1 (Nucleoporin GLE1; hGLE1; GLE1-like Protein; GLE1L) (FITC); anti-GLE1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1D8
• Specificity: Recognizes human GLE1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).

• Applicable Applications for anti-GLE1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa140-240 from human GLE1 (NP_001003722.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: RMKGTEGLRLWQEEQERKVQALSEMASEQLKRFDEWKELKQHKEFQDLREVMEKSSREALGHQEKLKAEHRHRAKILNLKLREAEQQRVKQAEQERLRKEE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (36.85kD).)

Testing Data

(Detection limit for recombinant GST tagged GLE1 is 0.1ng/ml as a capture antibody.)

Related Product Information for anti-GLE1 antibody

Required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. May be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC).

Product Categories/Family for anti-GLE1 antibody

Antibodies; Proteins

NCBI and Uniprot Product Information

• NCBI GI #: 51317384
• NCBI GeneID: 2733
• NCBI Accession #: NP_001003722.1
• NCBI GenBank Nucleotide #: NM_001003722
• UniProt Accession #: Q53GS7; O75458; Q53GT9; Q5VVU1; Q8NCP6; Q9UFL6
• Molecular Weight: 79,836 Da
• NCBI Official Full Name: nucleoporin GLE1 isoform 1
• NCBI Official Synonym Full Names: GLE1 RNA export mediator
• NCBI Official Symbol: GLE1
• NCBI Official Synonym Symbols: LCCS; GLE1L; LCCS1; hGLE1
• NCBI Protein Information: nucleoporin GLE1; GLE1-like protein; GLE1-like, RNA export mediator; GLE1 RNA export mediator homolog
• UniProt Protein Name: Nucleoporin GLE1
• Protein Family: Protein
• UniProt Gene Name: GLE1
• UniProt Synonym Gene Names: GLE1L; hGLE1
• UniProt Entry Name: GLE1_HUMAN

Uniprot Description

GLE1: Required for the export of mRNAs containing poly(A) tails from the nucleus into the cytoplasm. May be involved in the terminal step of the mRNA transport through the nuclear pore complex (NPC). Defects in GLE1 are the cause of lethal congenital contracture syndrome type 1 (LCCS1); also known as multiple contracture syndrome type Finnish. LCCS is an autosomal recessive disorder characterized by early fetal hydrops and akinesia, micrognatia, pulmonary hypoplasia, pterygia, multiple joint contractures, specific neuropathology with degeneration of anterior horn neurons and extreme skeletal muscle atrophy. LCCS1 leads to prenatal death. Defects in GLE1 are the cause of lethal arthrogryposis with anterior horn cell disease (LAAHD). LAAHD is characterized by fetal akinesia, arthrogryposis and motor neuron loss. LAADH fetus often survive delivery, but die early as a result of respiratory failure. Neuropathological findings resemble those of LCCS1, but are less severe. Belongs to the GLE1 family. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: Karyopherin; Nuclear export

Chromosomal Location of Human Ortholog: 9q34.11

Cellular Component: extracellular space; membrane; cytoplasm; plasma membrane; nuclear pore

Molecular Function: identical protein binding; protein binding

Biological Process: poly(A)+ mRNA export from nucleus; mRNA export from nucleus; protein transport

Disease: Lethal Arthrogryposis With Anterior Horn Cell Disease; Lethal Congenital Contracture Syndrome 1