Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Mouse anti-Human GHR Monoclonal Antibody | anti-GHR antibody

GHR (Growth Hormone Receptor, GH Receptor, Somatotropin Receptor) (MaxLight 550)

Gene Names
GHR; GHBP; GHIP
Reactivity
Human
Applications
Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
GHR; Monoclonal Antibody; GHR (Growth Hormone Receptor; GH Receptor; Somatotropin Receptor) (MaxLight 550); anti-GHR antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3A12
Specificity
Recognizes human GHR.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with MaxLight550.
Applicable Applications for anti-GHR antibody
FLISA, Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa19-118 from human GHR (NP_000154) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
FSGSEATAAILSRAPWSLQSVNPGLKTNSSKEPKFTKCRSPERETFSCHWTDEVHHGTKNLGPIQLFYTRRNTQEWTQEWKECPDYVSAGENSCYFNSSF
Conjugate
MaxLight550
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: MaxLight550 conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
Related Product Information for anti-GHR antibody
MaxLight550 is a new Yellow-Green photostable dye conjugate comparable to Alexa Fluor546, 555, DyLight549, Cy3, TRITC and offers better labeling efficiency, brighter imaging and increased immunodetection. Absorbance (550nm); Emission (575nm); Extinction Coefficient 150,000.
Product Categories/Family for anti-GHR antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
29.4kDa (254aa) 28-40kDa (SDS-PAGE under reducing conditions)
NCBI Official Full Name
growth hormone receptor isoform 1
NCBI Official Synonym Full Names
growth hormone receptor
NCBI Official Symbol
GHR
NCBI Official Synonym Symbols
GHBP; GHIP
NCBI Protein Information
growth hormone receptor
UniProt Protein Name
Growth hormone receptor
Protein Family
UniProt Gene Name
GHR
UniProt Synonym Gene Names
GH receptor; GH-binding protein; GHBP
UniProt Entry Name
GHR_HUMAN

NCBI Description

This gene encodes a member of the type I cytokine receptor family, which is a transmembrane receptor for growth hormone. Binding of growth hormone to the receptor leads to receptor dimerization and the activation of an intra- and intercellular signal transduction pathway leading to growth. Mutations in this gene have been associated with Laron syndrome, also known as the growth hormone insensitivity syndrome (GHIS), a disorder characterized by short stature. In humans and rabbits, but not rodents, growth hormone binding protein (GHBP) is generated by proteolytic cleavage of the extracellular ligand-binding domain from the mature growth hormone receptor protein. Multiple alternatively spliced transcript variants have been found for this gene.[provided by RefSeq, Jun 2011]

Uniprot Description

GH receptor: Receptor for pituitary gland growth hormone involved in regulating postnatal body growth. On ligand binding, couples to the JAK2/STAT5 pathway. Defects in GHR are a cause of Laron syndrome (LARS). A severe form of growth hormone insensitivity characterized by growth impairment, short stature, dysfunctional growth hormone receptor, and failure to generate insulin-like growth factor I in response to growth hormone. Defects in GHR may be a cause of idiopathic short stature autosomal (ISSA). Short stature is defined by a subnormal rate of growth. Belongs to the type I cytokine receptor family. Type 1 subfamily. 4 isoforms of the human protein are produced by alternative splicing.

Protein type: Receptor, cytokine; Membrane protein, integral

Chromosomal Location of Human Ortholog: 5p13-p12

Cellular Component: extracellular space; cell surface; integral to plasma membrane; extracellular region; plasma membrane; integral to membrane; receptor complex

Molecular Function: hematopoietin/interferon-class (D200-domain) cytokine receptor activity; protein binding; protein homodimerization activity; peptide hormone binding; growth factor binding; protein kinase binding

Biological Process: succinate metabolic process; oxaloacetate metabolic process; activation of MAPK activity; positive regulation of multicellular organism growth; tyrosine phosphorylation of JAK2 protein; fatty acid metabolic process; response to estradiol stimulus; 2-oxoglutarate metabolic process; positive regulation of tyrosine phosphorylation of Stat3 protein; allantoin metabolic process; receptor internalization; creatinine metabolic process; isoleucine metabolic process; cytokine and chemokine mediated signaling pathway; valine metabolic process; citrate metabolic process; regulation of multicellular organism growth; endocytosis; JAK-STAT cascade; creatine metabolic process; multicellular organismal metabolic process; cellular response to hormone stimulus; positive regulation of peptidyl-tyrosine phosphorylation; insulin-like growth factor receptor signaling pathway; positive regulation of tyrosine phosphorylation of Stat5 protein; response to cycloheximide; taurine metabolic process

Disease: Hypercholesterolemia, Familial; Laron Syndrome

Research Articles on GHR

Similar Products

Product Notes

The GHR ghr (Catalog #AAA6211674) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The GHR (Growth Hormone Receptor, GH Receptor, Somatotropin Receptor) (MaxLight 550) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's GHR can be used in a range of immunoassay formats including, but not limited to, FLISA, Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GHR ghr for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GHR, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.