Testing Data
(Detection limit for recombinant GST tagged GCM1 is approximately 3ng/ml as a capture antibody.)
Mouse GCM1 Monoclonal Antibody | anti-GCM1 antibody
GCM1 (glial Cells missing Homolog 1 (Drosophila), GCMA, hGCMa) (HRP)
Gene Names
GCM1; GCMA; hGCMa
Applications
Immunofluorescence
Purity
Purified
Synonyms
GCM1; Monoclonal Antibody; GCM1 (glial Cells missing Homolog 1 (Drosophila); GCMA; hGCMa) (HRP); glial Cells missing Homolog 1 (Drosophila); hGCMa; anti-GCM1 antibody
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3G7
Specificity
Recognizes GCM1.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
Applicable Applications for anti-GCM1 antibody
Immunofluorescence (IF)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
GCM1 (NP_003634, 108aa-166aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
QQRKRCPNCDGPLKLIPCRGHGGFPVTNFWRHDGRFIFFQSKGEHDHPKPETKLEAEA*
Conjugate
HRP
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
Testing Data
(Detection limit for recombinant GST tagged GCM1 is approximately 3ng/ml as a capture antibody.)
Testing Data
(Detection limit for recombinant GST tagged GCM1 is approximately 3ng/ml as a capture antibody.)
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml])
Immunofluorescence (IF)
(Immunofluorescence of monoclonal antibody to GCM1 on HeLa cell. [antibody concentration 10 ug/ml])
Product Categories/Family for anti-GCM1 antibody
NCBI and Uniprot Product Information
NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
Molecular Weight
49,268 Da
NCBI Official Full Name
chorion-specific transcription factor GCMa
NCBI Official Synonym Full Names
glial cells missing homolog 1 (Drosophila)
NCBI Official Symbol
GCM1
NCBI Official Synonym Symbols
GCMA; hGCMa
NCBI Protein Information
chorion-specific transcription factor GCMa; GCM motif protein 1
UniProt Protein Name
Chorion-specific transcription factor GCMa
Protein Family
UniProt Gene Name
GCM1
UniProt Synonym Gene Names
GCMA; hGCMa
UniProt Entry Name
GCM1_HUMAN
Similar Products
Product Notes
The GCM1 gcm1 (Catalog #AAA6179740) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's GCM1 can be used in a range of immunoassay formats including, but not limited to, Immunofluorescence (IF). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the GCM1 gcm1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "GCM1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.Precautions
All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.Disclaimer
Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.Item has been added to Shopping Cart
If you are ready to order, navigate to Shopping Cart and get ready to checkout.
