Mouse GATA1 Monoclonal Antibody | anti-GATA1 antibody

GATA1 (Erythroid Transcription Factor, Eryf1, GATA-binding Factor 1, GATA-1, GF-1, NF-E1 DNA-binding Protein, ERYF1, GF1) (HRP)

Cat. Num. AAA6152637

• Gene Names: GATA1; GF1; GF-1; NFE1; XLTT; ERYF1; NF-E1; XLANP; XLTDA; GATA-1
• Reactivity: Human, Mouse, Rat
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: GATA1; Monoclonal Antibody; GATA1 (Erythroid Transcription Factor; Eryf1; GATA-binding Factor 1; GATA-1; GF-1; NF-E1 DNA-binding Protein; ERYF1; GF1) (HRP); anti-GATA1 antibody

• Host: Mouse
• Reactivity: Human, Mouse, Rat
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 3G6
• Specificity: Recognizes human GATA1. Species Crossreactivity: mouse and rat.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
• Sequence Length: 1464

• Applicable Applications for anti-GATA1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa123-199 from human GATA1 (NM_002049) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: DLDGKGSTSFLETLKTERLSPDLLTLGPALPSSLPVPNSAYGGPDFSSTFFSPTGSPLNSAAYSSPKLRGTLPLPPC
• Conjugate: HRP
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (34.21kD).)

Western Blot (WB)

(GATA1 monoclonal antibody. Western Blot analysis of GATA1 expression in PC-12.)

Western Blot (WB)

(GATA1 monoclonal antibody. Western Blot analysis of GATA1 expression in Raw 264.7.)

Western Blot (WB)

(GATA1 monoclonal antibody. Western Blot analysis of GATA1 expression in Jurkat.)

Related Product Information for anti-GATA1 antibody

GATA1 is the founding member of a family of transcription factors distinguished by a zinc finger domain that recognizes the DNA consensus motif (A/T)GATA(A/G). Functionally important GATA motifs have been identified in the regulatory regions of virtually all erythroid-expressed genes, including globins, heme biosynthetic enzymes, erythroid transcription factors and erythroid membrane proteins. GATA1 is thus a DNA-binding protein, essential for the survival and maturation of lineage-committed erythroid precursors. GATA1 is required for normal erythropoiesis. Human GATA1 gene is mapped to chromosomal region Xp11.23.

Product Categories/Family for anti-GATA1 antibody

Antibodies; Transcription Factors

NCBI and Uniprot Product Information

• NCBI GI #: 1732746194
• NCBI GeneID: 2623
• NCBI Accession #: NM_002049.4
• NCBI GenBank Nucleotide #: NM_002049
• UniProt Accession #: P15976
• NCBI Official Full Name: Homo sapiens GATA binding protein 1 (GATA1), mRNA
• NCBI Official Synonym Full Names: GATA binding protein 1
• NCBI Official Symbol: GATA1
• NCBI Official Synonym Symbols: GF1; GF-1; NFE1; XLTT; ERYF1; NF-E1; XLANP; XLTDA; GATA-1
• NCBI Protein Information: erythroid transcription factor
• UniProt Protein Name: Erythroid transcription factor
• Protein Family: GATA transcription factor
• UniProt Gene Name: GATA1
• UniProt Synonym Gene Names: ERYF1; GF1; GATA-1; GF-1
• UniProt Entry Name: GATA1_HUMAN

NCBI Description

This gene encodes a protein which belongs to the GATA family of transcription factors. The protein plays an important role in erythroid development by regulating the switch of fetal hemoglobin to adult hemoglobin. Mutations in this gene have been associated with X-linked dyserythropoietic anemia and thrombocytopenia. [provided by RefSeq, Jul 2008]

Uniprot Description

GATA1: Transcriptional activator which probably serves as a general switch factor for erythroid development. It binds to DNA sites with the consensus sequence [AT]GATA[AG] within regulatory regions of globin genes and of other genes expressed in erythroid cells. May form homodimers or heterodimers with other isoforms. Interacts (via the N-terminal zinc finger) with ZFPM1. Interacts with GFI1B. Interacts with PIAS4; the interaction enhances sumoylation and represses the transactivational activity in a sumoylation-independent manner. Interacts with LMCD1. Interacts with CREBBP; the interaction stimulates acetylation and transcriptional activity in vivo. Interacts with EP300. Erythrocytes. 3 isoforms of the human protein are produced by alternative splicing.

Protein type: DNA-binding; Transcription factor

Chromosomal Location of Human Ortholog: Xp11.23

Cellular Component: nucleoplasm; transcription factor complex; transcriptional repressor complex; nucleus

Molecular Function: protein binding; DNA binding; zinc ion binding; chromatin DNA binding; p53 binding; sequence-specific DNA binding; DNA bending activity; transcription factor activity

Biological Process: transcription from RNA polymerase II promoter; erythrocyte development; embryonic hemopoiesis; megakaryocyte differentiation; in utero embryonic development; positive regulation of erythrocyte differentiation; eosinophil differentiation; male gonad development; negative regulation of transcription from RNA polymerase II promoter; negative regulation of cell proliferation; negative regulation of bone mineralization; positive regulation of peptidyl-tyrosine phosphorylation; cell-cell signaling; positive regulation of osteoblast proliferation; erythrocyte differentiation; positive regulation of transcription from RNA polymerase II promoter; platelet formation; blood coagulation; basophil differentiation; negative regulation of apoptosis

Disease: Thrombocytopenia With Beta-thalassemia, X-linked; Anemia, X-linked, With Or Without Neutropenia And/or Platelet Abnormalities; Thrombocytopenia, X-linked, With Or Without Dyserythropoietic Anemia; Down Syndrome