Highly validated and characterized monoclonal/polyclonal
antibodies and recombinant
proteins
The majority of AAA Biotech’s antibodies are highly validated and can be use in multiple
applications such as ELISA, FC,
ICC, IF, IHC, IP, WB, etc. We have antibodies available for rare species, in multiple conjugated
forms or recombinant
antibodies.
As for our high quality proteins, the majority have 90% purity, detected by SDS-PAGE while some are
available in
different tags such as Flag, GST, His, MBP, etc. We also carry high quality native and biologically
active proteins.
AAA Biotech is constantly working to expand our capacity to provide recombinant proteins and
antibodies to most
target proteins.
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27531'
AND `pd`.`language_id` = 1
LIMIT 1
Query
Database
1.94 ms
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27531' and pd.language_id = 1
Query
Database
1.59 ms
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27531'
Database (4 total Queries, 4 of them unique across 2 Connections)
Time
Query String
2.62 ms
SELECT `p`.*, `pd`.*, IFNULL(pdns.ncbi_summary, "N/A") as ncbi_summary_pdns, IFNULL(pdns.sp_comments, "N/A") as sp_comments_pdns, IFNULL(pdns.ncbi_research_articles, "N/A") as ncbi_research_articles_pdns, IFNULL(pe.products_description_extra, "N/A") as products_description_extra
FROM (`products`, `products` as `p`)
LEFT OUTER JOIN `products_description` as `pd` ON `p`.`products_id` = `pd`.`products_id`
LEFT OUTER JOIN `products_description_ncbi_sp` as `pdns` ON `p`.`products_id` = `pdns`.`products_id`
LEFT OUTER JOIN `products_extra` as `pe` ON `p`.`products_id` = `pe`.`products_id`
WHERE `p`.`products_id` = '27531'
AND `pd`.`language_id` = 1
LIMIT 1
select p.*, pd.*,
ifnull(pdns.ncbi_summary, 'N/A') as ncbi_summary_pdns,
ifnull(pdns.sp_comments, 'N/A') as sp_comments_pdns,
ifnull(pdns.ncbi_research_articles, 'N/A') as ncbi_research_articles_pdns,
ifnull(pe.products_description_extra, 'N/A') as products_description_extra
from products p
LEFT OUTER JOIN products_description pd on p.products_id = pd.products_id
LEFT OUTER JOIN products_description_ncbi_sp pdns on p.products_id = pdns.products_id
LEFT OUTER JOIN products_extra pe on p.products_id = pe.products_id
where p.products_id = '27531' and pd.language_id = 1
SELECT `options_values_price` as `price`, `products_options_values_name` as `package`
FROM `products_attributes`
JOIN `products_options_values` ON `products_options_values`.`products_options_values_id` = `products_attributes`.`options_values_id`
WHERE `products_attributes`.`products_id` = '27531'
⇄⧉specificity => string (173) "This assay has high sensitivity and excellent specificity for detection of s...
$value['specificity']
This assay has high sensitivity and excellent specificity for detection of sCD163. No significant cross-reactivity or interference between sCD163 and analogues was observed.
⇄purity => string (3) "N/A"
$value['purity']
⇄form => string (3) "N/A"
$value['form']
⇄concentration => string (3) "N/A"
$value['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value['products_references']
⇄⧉products_related_diseases => string (206) "Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||7...
$value['products_related_diseases']
Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||76!!Brain Diseases||50!!Lung Diseases||34!!Adenocarcinoma||27!!Heart Diseases||22!!Kidney Diseases||21!!Neoplasms, Experimental||17
⇄⧉specificity => string (173) "This assay has high sensitivity and excellent specificity for detection of s...
$value->a['specificity']
This assay has high sensitivity and excellent specificity for detection of sCD163. No significant cross-reactivity or interference between sCD163 and analogues was observed.
⇄purity => string (3) "N/A"
$value->a['purity']
⇄form => string (3) "N/A"
$value->a['form']
⇄concentration => string (3) "N/A"
$value->a['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value->a['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value->a['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value->a['products_references']
⇄⧉products_related_diseases => string (206) "Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||7...
$value->a['products_related_diseases']
Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||76!!Brain Diseases||50!!Lung Diseases||34!!Adenocarcinoma||27!!Heart Diseases||22!!Kidney Diseases||21!!Neoplasms, Experimental||17
⇄⧉specificity => string (173) "This assay has high sensitivity and excellent specificity for detection of s...
$value->d['specificity']
This assay has high sensitivity and excellent specificity for detection of sCD163. No significant cross-reactivity or interference between sCD163 and analogues was observed.
⇄purity => string (3) "N/A"
$value->d['purity']
⇄form => string (3) "N/A"
$value->d['form']
⇄concentration => string (3) "N/A"
$value->d['concentration']
⇄⧉storage_stability => string (156) "Store entire kit at 2-8C for short-term. For longer-term, please store the m...
$value->d['storage_stability']
Store entire kit at 2-8C for short-term. For longer-term, please store the microplate & standard at -20C, while the remaining reagents can be stored at 2-8C
⇄⧉products_description => string (825) "Principle of the Assay: This kit was based on sandwich enzyme-linked immune-...
$value->d['products_description']
Principle of the Assay: This kit was based on sandwich enzyme-linked immune-sorbent assay technology. Capture antibody was pre-coated onto 96-well plates. And the biotin conjugated antibody was used as detection antibodies. The standards, test samples and biotin conjugated detection antibody were added to the wells subsequently, and washed with wash buffer. HRP-Streptavidin was added and unbound conjugates were washed away with wash buffer. TMB substrates were used to visualize HRP enzymatic reaction. TMB was catalyzed by HRP to produce a blue color product that changed into yellow after adding acidic stop solution. The density of yellow is proportional to the target amount of sample captured in plate. Read the O.D. absorbance at 450nm in a microplate reader, and then the concentration of target can be calculated.
⇄products_references => string (3) "N/A"
$value->d['products_references']
⇄⧉products_related_diseases => string (206) "Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||7...
$value->d['products_related_diseases']
Inflammation||270!!Neoplasms||200!!Necrosis||120!!Nervous System Diseases||76!!Brain Diseases||50!!Lung Diseases||34!!Adenocarcinoma||27!!Heart Diseases||22!!Kidney Diseases||21!!Neoplasms, Experimental||17
⇄⧉etc_term1 => string (175) "Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue hom...
$value[0]['_source']['etc_term1']
Samples||Serum, plasma, Cell Culture Supernatants, body fluid and tissue homogenate!!Assay Type||Competitive or Sandwich!!Detection Range||5.0-100ng/mL!!Sensitivity||1.0 ng/mL
⇄products_name_oem => string (39) "Human Heparin binding protein ELISA Kit"
$value[0]['_source']['products_name_oem']
⇄products_name_syn => string (3) "N/A"
$value[0]['_source']['products_name_syn']
⇄products_gene_name => string (7) "AZU/HBP"
$value[0]['_source']['products_gene_name']
⇄products_gene_name_syn => string (3) "N/A"
$value[0]['_source']['products_gene_name_syn']
⇄⧉products_description => string (1407) "Intended Uses: This HBP ELISA kit is a 1.5 hour solid-phase ELISA designed f...
$value[0]['_source']['products_description']
Intended Uses: This HBP ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of Human HBP.<br><br>Principle of the Assay: HBP ELISA kit applies the quantitative sandwich enzyme immunoassay technique. The microtiter plate has been pre-coated with a monoclonal antibody specific for HBP. Standards or samples are then added to the microtiter plate wells and HBP if present, will bind to the antibody pre-coated wells. In order to quantitatively determine the amount of HBP present in the sample, a standardized preparation of horseradish peroxidase (HRP)-conjugated polyclonal antibody, specific for HBP are added to each well to "sandwich" the HBP immobilized on the plate. The microtiter plate undergoes incubation, and then the wells are thoroughly washed to remove all unbound components. Next, substrate solutions are added to each well. The enzyme (HRP) and substrate are allowed to react over a short incubation period. Only those wells that contain HBP and enzyme-conjugated antibody will exhibit a change in color. The enzyme-substrate reaction is terminated by addition of a sulphuric acid solution and the color change is measured spectrophotometrically at a wavelength of 450 nm. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The HBP concentration in each sample is interpolated from this standard curve.
⇄⧉search_terms => string (441) "aaa16908 human typical testing data standard curve for reference only aaa169...
$value[0]['_source']['search_terms']
aaa16908 human typical testing data standard curve for reference only aaa16908_td elisa kit heparin binding protein azu hbp 26,264 da fibroblast growth factor 1 17 kda hbgf hbp17 fgfbp1 fgfbp fgf bp bp1 fgfp1_human 183951 aaa58636.1 a8k5j2 607737 samples serum plasma cell culture supernatants body fluid and tissue homogenate assay type competitive or sandwich detection range 5.0 100ng ml sensitivity 1.0 ng factor1 range5.0 sensitivity1.0
⇄⧉products_description => string (833) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[1]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Porcine bFGF/FGF2 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[1]['_source']['products_references']
⇄⧉products_related_diseases => string (218) "Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Inj...
$value[1]['_source']['products_related_diseases']
Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Injuries||530!!Heart Diseases||395!!Inflammation||394!!Myocardial Ischemia||327!!Drug Toxicity||317!!Disease Progression||309!!Lung Diseases||292
⇄⧉ncbi_pathways => string (456) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[1]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Angiogenesis Pathway||198772!!Angiopoietin Receptor Tie2-mediated Signaling Pathway||137917!!Cardiac Progenitor Differentiation Pathway||712094!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250
⇄⧉search_terms => string (510) "aaa12918 porcine no cross reaction with other factors typical testing data s...
$value[1]['_source']['search_terms']
aaa12918 porcine no cross reaction with other factors typical testing data standard curve for reference only aaa12918_sc elisa kit basic fibroblast growth factor bfgf fgf2 partial 2 fgfb fgf hbgf prostatropin heparin binding 21,203 da fgf2_human 183087 aaa52534.1 p09038 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 134920 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision partial2 to5
⇄⧉products_description => string (826) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[2]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human FGF9 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[2]['_source']['products_references']
⇄⧉products_related_diseases => string (205) "Neoplasms||38!!Nervous System Diseases||13!!Adenocarcinoma||10!!Cardiovascul...
$value[2]['_source']['products_related_diseases']
Neoplasms||38!!Nervous System Diseases||13!!Adenocarcinoma||10!!Cardiovascular Diseases||8!!Lung Diseases||7!!Hypertrophy||7!!Heart Diseases||6!!Cleft Palate||5!!Endometrial Neoplasms||5!!Lung Neoplasms||5
⇄⧉ncbi_pathways => string (467) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[2]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250!!Downstream Signal Transduction Pathway||106385!!Downstream Signaling Of Activated FGFR Pathway||160957!!FGFR Ligand Binding And Activation Pathway||106344
⇄⧉search_terms => string (519) "aaa12468 human no cross reaction with other factors typical testing data sta...
$value[2]['_source']['search_terms']
aaa12468 human no cross reaction with other factors typical testing data standard curve for reference only aaa12468_sc elisa kit fibroblast growth factor 9 fgf9 gaf fgf syns3 hbfg hbgf heparin binding glia activating 23,441 da fgf9_human 4503707 np_002001.1 p31371 nm_002010.2 q3sy32 a8k427 gene 612961 samples serum plasma or cell culture supernatant and organizations in the natural recombinant fgf23 concentration assay type sandwich detection range 1000 pg ml 15.6 sensitivity 5 intra precision factor9 sensitivity5
⇄⧉products_description => string (831) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[3]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Human bFGF/FGF2 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[3]['_source']['products_references']
⇄⧉products_related_diseases => string (218) "Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Inj...
$value[3]['_source']['products_related_diseases']
Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Injuries||530!!Heart Diseases||395!!Inflammation||394!!Myocardial Ischemia||327!!Drug Toxicity||317!!Disease Progression||309!!Lung Diseases||292
⇄⧉ncbi_pathways => string (456) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[3]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Angiogenesis Pathway||198772!!Angiopoietin Receptor Tie2-mediated Signaling Pathway||137917!!Cardiac Progenitor Differentiation Pathway||712094!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250
⇄⧉products_description => string (825) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[4]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Mouse KGF monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄⧉ncbi_pathways => string (467) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[4]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250!!Downstream Signal Transduction Pathway||106385!!Downstream Signaling Of Activated FGFR Pathway||160957!!FGFR Ligand Binding And Activation Pathway||106344
⇄⧉search_terms => string (407) "aaa12732 mouse typical testing data standard curve for reference only aaa127...
$value[4]['_source']['search_terms']
aaa12732 mouse typical testing data standard curve for reference only aaa12732_sc elisa kit keratinocyte growth factor kgf fibroblast 7 fgf7 hbgf fgf heparin binding 11,520 da fgf7_human 245439 aab21431.1 p21781 q6fgv5 q96fg5 h0yny5 148180 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 2000 pg ml 31.2 sensitivity up to 12 intra precision fibroblast7 to12
⇄⧉products_description => string (833) "Principle of the Assay: As mentioned above, this kit utilizes the Double Ant...
$value[5]['_source']['products_description']
Principle of the Assay: As mentioned above, this kit utilizes the Double Antibody Sandwich ELISA technique. The pre-coated antibody is an anti-Chicken bFGF/FGF2 monoclonal antibody, while the detection antibody is a biotinylated polyclonal antibody. Samples and biotinylated antibodies are added into ELISA plate wells and washed out with PBS or TBS after their respective additions to the wells. Then Avidin-peroxidase conjugates are added to the wells in after. TMB substrate is used for coloration after the enzyme conjugate has already been thoroughly washed out of the wells by PBS or TBS. TMB reacts to form a blue product from the peroxidase activity, and finally turns to yellow after addition of the stop solution (Color Reagent C). The color intensity and quantity of target analyte in the sample are positively correlated.
⇄products_references => string (3) "N/A"
$value[5]['_source']['products_references']
⇄⧉products_related_diseases => string (218) "Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Inj...
$value[5]['_source']['products_related_diseases']
Neoplasms||2566!!Nervous System Diseases||928!!Necrosis||578!!Wounds and Injuries||530!!Heart Diseases||395!!Inflammation||394!!Myocardial Ischemia||327!!Drug Toxicity||317!!Disease Progression||309!!Lung Diseases||292
⇄⧉ncbi_pathways => string (456) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[5]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Angiogenesis Pathway||198772!!Angiopoietin Receptor Tie2-mediated Signaling Pathway||137917!!Cardiac Progenitor Differentiation Pathway||712094!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250
⇄⧉search_terms => string (510) "aaa13093 chicken no cross reaction with other factors typical testing data s...
$value[5]['_source']['search_terms']
aaa13093 chicken no cross reaction with other factors typical testing data standard curve for reference only aaa13093_sc elisa kit basic fibroblast growth factor bfgf fgf2 partial 2 fgfb fgf hbgf prostatropin heparin binding 21,203 da fgf2_human 183087 aaa52534.1 p09038 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 134920 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 1000 pg ml 15.6 sensitivity up to 5 intra precision partial2 to5
⇄⧉specificity => string (193) "This assay has high sensitivity and excellent specificity for detection of m...
$value[6]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse aFGF/FGF-1. No significant cross-reactivity or interference between mouse aFGF/FGF-1 and analogues was observed.
⇄purity => string (3) "N/A"
$value[6]['_source']['purity']
⇄form => string (3) "N/A"
$value[6]['_source']['form']
⇄concentration => string (3) "N/A"
$value[6]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[6]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[6]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (755) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[6]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for aFGF/FGF-1 has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any aFGF/FGF-1 present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for aFGF/FGF-1 is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of aFGF/FGF-1 bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄products_references => string (3) "N/A"
$value[6]['_source']['products_references']
⇄⧉products_related_diseases => string (224) "Nervous System Diseases||136!!Breast Neoplasms||69!!Heart Diseases||62!!Infl...
$value[6]['_source']['products_related_diseases']
Nervous System Diseases||136!!Breast Neoplasms||69!!Heart Diseases||62!!Inflammation||58!!Necrosis||57!!Myocardial Ischemia||55!!Neoplasms, Experimental||43!!Hyperplasia||39!!Fibrosis||33!!Cell Transformation, Neoplastic||33
⇄⧉ncbi_pathways => string (453) "Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pa...
$value[6]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pathway||971210!!Constitutive PI3K/AKT Signaling In Cancer Pathway||1000676!!DAP12 Interactions Pathway||971203!!DAP12 Signaling Pathway||971214!!Disease Pathway||970606!!Downstream Signal Transduction Pathway||971469!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||1001193!!Downstream Signaling Of Activated FGFR Pathway||971322!!ESC Pluripotency Pathways||198374
⇄⧉search_terms => string (697) "aaa14978 mouse this assay has high sensitivity and excellent specificity for...
$value[6]['_source']['search_terms']
aaa14978 mouse this assay has high sensitivity and excellent specificity for detection of afgf fgf 1 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa14978_td elisa kit fibroblast growth factor acidic ecgf beta ecgfa ecgfb alpha fgfa glio703 hbgf1 otthump00000066031 endothelial cell heparin binding fgf1 fam dffrx hbgf 17,418 da fgf1_mouse 6753850 np_034327.1 p61148 nm_010197.3 p10935 samples serum plasma tissue homogenates type quantitative sandwich range 6.25 pg ml 400 < 1.56 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in ml400
⇄⧉specificity => string (175) "This assay has high sensitivity and excellent specificity for detection of r...
$value[7]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of rat KGF. No significant cross-reactivity or interference between rat KGF and analogues was observed.
⇄purity => string (3) "N/A"
$value[7]['_source']['purity']
⇄form => string (3) "N/A"
$value[7]['_source']['form']
⇄concentration => string (3) "N/A"
$value[7]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[7]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[7]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (727) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[7]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for KGF has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any KGF present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for KGF is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of KGF bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_pathways => string (477) "Activated Point Mutants Of FGFR2 Pathway||1010497!!Adaptive Immune System Pa...
$value[7]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||1010497!!Adaptive Immune System Pathway||1010925!!Constitutive PI3K/AKT Signaling In Cancer Pathway||1010535!!DAP12 Interactions Pathway||1011029!!DAP12 Signaling Pathway||1011030!!Disease Pathway||1010484!!Downstream Signal Transduction Pathway||1010117!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||1010939!!Downstream Signaling Of Activated FGFR Pathway||1010048!!FGFR Ligand Binding And Activation Pathway||1010034
⇄⧉search_terms => string (588) "aaa15197 rat this assay has high sensitivity and excellent specificity for d...
$value[7]['_source']['search_terms']
aaa15197 rat this assay has high sensitivity and excellent specificity for detection of kgf no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15197_td elisa kit fibroblast growth factor 7 keratinocyte hbgf heparin binding fgf7 fgf 22,268 da fgf7_rat 11559943 np_071518.1 q02195 nm_022182.1 samples serum plasma type quantitative sandwich range 31.25 pg ml 2000 < 7.8 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in factor7 <7.8
⇄⧉specificity => string (179) "This assay has high sensitivity and excellent specificity for detection of m...
$value[8]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of mouse KGF. No significant cross-reactivity or interference between mouse KGF and analogues was observed.
⇄purity => string (3) "N/A"
$value[8]['_source']['purity']
⇄form => string (3) "N/A"
$value[8]['_source']['form']
⇄concentration => string (3) "N/A"
$value[8]['_source']['concentration']
⇄⧉storage_stability => string (129) "Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please ...
$value[8]['_source']['storage_stability']
Unopened test kits should be stored at 2 to 8 degree C upon receipt. Please refer to pdf manual for further storage instructions.
⇄⧉etc_term2 => string (327) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV...
$value[8]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): CV%<8%. Three samples of known concentration were tested twenty times on one plate to assess.!!Inter-assay Precision||Inter-assay Precision (Precision between assays): CV%<10%. Three samples of known concentration were tested in twenty assays to assess.
⇄⧉products_description => string (727) "Principle of the Assay: This assay employs the quantitative sandwich enzyme ...
$value[8]['_source']['products_description']
Principle of the Assay: This assay employs the quantitative sandwich enzyme immunoassay technique. Antibody specific for KGF has been pre-coated onto a microplate. Standards and samples are pipetted into the wells and any KGF present is bound by the immobilized antibody. After removing any unbound substances, a biotin-conjugated antibody specific for KGF is added to the wells. After washing, avidin conjugated Horseradish Peroxidase (HRP) is added to the wells. Following a wash to remove any unbound avidin-enzyme reagent, a substrate solution is added to the wells and color develops in proportion to the amount of KGF bound in the initial step. The color development is stopped and the intensity of the color is measured.
⇄⧉ncbi_pathways => string (453) "Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pa...
$value[8]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pathway||971210!!Constitutive PI3K/AKT Signaling In Cancer Pathway||1000676!!DAP12 Interactions Pathway||971203!!DAP12 Signaling Pathway||971214!!Disease Pathway||970606!!Downstream Signal Transduction Pathway||971469!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||1001193!!Downstream Signaling Of Activated FGFR Pathway||971322!!ESC Pluripotency Pathways||198374
⇄⧉search_terms => string (634) "aaa15122 mouse this assay has high sensitivity and excellent specificity for...
$value[8]['_source']['search_terms']
aaa15122 mouse this assay has high sensitivity and excellent specificity for detection of kgf no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa15122_td elisa kit fibroblast growth factor 7 keratinocyte fgf hbgf heparin binding fgf7 22,347 da fgf7_mouse 6679785 np_032034.1 p36363 nm_008008.4 samples serum plasma cell culture supernates tissue homogenates type quantitative sandwich range 1.56 pg ml 100 < 0.39 intra precision within an cv <8 three known concentration were tested twenty times on one plate to assess inter assays <10 in factor7 ml100
⇄⧉etc_term1 => string (210) "Samples||Rabbit serum, plasma or Cell Culture Supernatant and organizations ...
$value[9]['_source']['etc_term1']
Samples||Rabbit serum, plasma or Cell Culture Supernatant and organizations in the natural and recombinant FGF2 concentration!!Assay Type||Sandwich!!Detection Range||1000 pg/ml-15.6 pg/ml!!Sensitivity||5 pg/ml.
⇄⧉products_description => string (676) "Principle of the assay: This experiment use double-sandwich elisa technique ...
$value[9]['_source']['products_description']
Principle of the assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is Rabbit FGF2 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄products_references => string (3) "N/A"
$value[9]['_source']['products_references']
⇄⧉products_related_diseases => string (212) "Nervous System Diseases||974!!Necrosis||604!!Wounds and Injuries||553!!Infla...
$value[9]['_source']['products_related_diseases']
Nervous System Diseases||974!!Necrosis||604!!Wounds and Injuries||553!!Inflammation||426!!Heart Diseases||414!!Myocardial Ischemia||344!!Disease Progression||331!!Lung Diseases||311!!Hyperplasia||254!!Glioma||224
⇄⧉search_terms => string (565) "aaa22415 rabbit no cross reaction with other factors typical testing data st...
$value[9]['_source']['search_terms']
aaa22415 rabbit no cross reaction with other factors typical testing data standard curve for reference only aaa22415_td elisa kit fibroblast growth factor 2 basic fgf2 bfgf fgfb fgf hbgf prostatropin heparin binding 21,203 da fgf2_human 153285461 np_001997.5 p09038 nm_002006.4 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 134920 samples serum plasma or cell culture supernatant and organizations in the natural recombinant concentration assay type sandwich detection range 1000 pg ml 15.6 sensitivity 5 intra precision factor2 sensitivity5
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of F...
$value[10]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGF2. No significant cross-reactivity or interference between FGF2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[10]['_source']['purity']
⇄form => string (3) "N/A"
$value[10]['_source']['form']
⇄concentration => string (3) "N/A"
$value[10]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[10]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Quantitative Competitive!!Samples||Bovine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids!!Detection Range||12.35-1,000pg/mL!!Sensitivity||< 5.15pg/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[10]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FGF2 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FGF2 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (992) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[10]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. A monoclonal antibody specific to FGF2 has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled FGF2 and unlabeled FGF2 (Standards or samples) with the pre-coated antibody specific to FGF2. After incubation the unbound conjugate is washed off. Next, avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. The amount of bound HRP conjugate is reverse proportional to the concentration of FGF2 in the sample. After addition of the substrate solution, the intensity of color developed is reverse proportional to the concentration of FGF2 in the sample.<br><br>Intended Uses: The kit is a competitive inhibition enzyme immunoassay technique for the in vitro quantitative measurement of FGF2 in bovine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
⇄products_references => string (3) "N/A"
$value[10]['_source']['products_references']
⇄⧉products_related_diseases => string (221) "Nervous System Diseases||1080!!Necrosis||635!!Wounds and Injuries||604!!Infl...
Nervous System Diseases||1080!!Necrosis||635!!Wounds and Injuries||604!!Inflammation||473!!Heart Diseases||430!!Disease Progression||357!!Myocardial Ischemia||354!!Lung Diseases||348!!Hyperplasia||263!!Lung Neoplasms||238
⇄⧉ncbi_pathways => string (469) "ARMS-mediated Activation Pathway||1269471!!Activated Point Mutants Of FGFR2 ...
$value[10]['_source']['ncbi_pathways']
ARMS-mediated Activation Pathway||1269471!!Activated Point Mutants Of FGFR2 Pathway||1268871!!Adaptive Immune System Pathway||1269171!!Angiogenesis Pathway||198772!!Angiopoietin Receptor Tie2-mediated Signaling Pathway||137917!!Axon Guidance Pathway||1270303!!Cardiac Progenitor Differentiation Pathway||712094!!Constitutive Signaling By Aberrant PI3K In Cancer Pathway||1268880!!Cytokine Signaling In Immune System Pathway||1269310!!DAP12 Interactions Pathway||1269283
⇄⧉search_terms => string (622) "aaa21000 bovine this assay has high sensitivity and excellent specificity fo...
$value[10]['_source']['search_terms']
aaa21000 bovine this assay has high sensitivity and excellent specificity for detection of fgf2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa21000_sc elisa kit fibroblast growth factor 2 basic b fgf bfgf fgfb hbgh heparin binding hbgf 21,203 da fgf2_human 153285461 np_001997.5 p09038 nm_002006.4 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 134920 cytokine tumor immunity infection samples serum plasma tissue homogenates cell lysates culture supernates other biological fluids range 12.35 1,000pg ml factor2
⇄⧉specificity => string (184) "The Mouse FGF1 ELISA Kit allows for the detection and quantification of endo...
$value[11]['_source']['specificity']
The Mouse FGF1 ELISA Kit allows for the detection and quantification of endogenous levels of natural and/or recombinant Mouse FGF1 proteins within the range of 15.6 pg/ml - 1000 pg/ml.
⇄purity => string (3) "N/A"
$value[11]['_source']['purity']
⇄form => string (3) "N/A"
$value[11]['_source']['form']
⇄concentration => string (3) "N/A"
$value[11]['_source']['concentration']
⇄⧉storage_stability => string (107) "Shipped and store at 4 degree C for 6 months, store at -20 degree C for one ...
$value[11]['_source']['storage_stability']
Shipped and store at 4 degree C for 6 months, store at -20 degree C for one year. Avoid freeze/thaw cycles.
⇄⧉products_description => string (1397) "Background: Heparin-binding growth factor 1 is a protein that in humans is e...
$value[11]['_source']['products_description']
Background: Heparin-binding growth factor 1 is a protein that in humans is encoded by the FGF1 gene. The protein encoded by this gene is a member of the fibroblast growth factor (FGF) family. This protein functions as a modifier of endothelial cell migration and proliferation, as well as an angiogenic factor. It acts as a mitogen for a variety of mesoderm- and neuroectoderm-derived cells in vitro, thus is thought to be involved in organogenesis. The FGF1 gene was mapped to chromosome 5q31.3-q33.2 by in situ hybridization.<br><br>Principle of the Assay: The Mouse FGF1 ELISA (Enzyme-Linked Immunosorbent Assay) kit is an in vitro enzyme-linked immunosorbent assay for the quantitative measurement of Mouse FGF1 in Cell Culture Supernatants, Serum, Plasma. This assay employs an antibody specific for Mouse FGF1 coated on a 96-well plate. Standards and samples are pipetted into the wells and FGF1 present in a sample is bound to the wells by the immobilized antibody. The wells are washed and biotinylated anti-Mouse FGF1 antibody is added. After washing away unbound biotinylated antibody, HRP-conjugated streptavidin is pipetted to the wells. The wells are again washed, a TMB substrate solution is added to the wells and color develops in proportion to the amount of FGF1 bound. The Stop Solution changes the color from blue to yellow, and the intensity of the color is measured at 450 nm.
⇄products_references => string (3) "N/A"
$value[11]['_source']['products_references']
⇄⧉products_related_diseases => string (222) "Nervous System Diseases||137!!Heart Diseases||63!!Necrosis||59!!Inflammation...
⇄⧉ncbi_pathways => string (453) "Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pa...
$value[11]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||1000637!!Adaptive Immune System Pathway||971210!!Constitutive PI3K/AKT Signaling In Cancer Pathway||1000676!!DAP12 Interactions Pathway||971203!!DAP12 Signaling Pathway||971214!!Disease Pathway||970606!!Downstream Signal Transduction Pathway||971469!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||1001193!!Downstream Signaling Of Activated FGFR Pathway||971322!!ESC Pluripotency Pathways||198374
⇄⧉specificity => string (379) "This assay has high sensitivity and excellent specificity for detection of F...
$value[12]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGF-7. No significant cross-reactivity or interference between FGF-7 and analogues was observed. NOTE: Limited by current skills and knowledge, it is impossible for us to complete the cross-reactivity detection between FGF-7 and all the analogues, therefore, cross reaction may still exist in some cases.
⇄purity => string (3) "N/A"
$value[12]['_source']['purity']
⇄form => string (3) "N/A"
$value[12]['_source']['form']
⇄concentration => string (3) "N/A"
$value[12]['_source']['concentration']
⇄storage_stability => string (35) "Store all reagents at 2-8 degree C."
⇄⧉products_description => string (1397) "Intended Uses: This FGF-7 ELISA kit is a 1.5 hour solid-phase ELISA designed...
$value[12]['_source']['products_description']
Intended Uses: This FGF-7 ELISA kit is a 1.5 hour solid-phase ELISA designed for the quantitative determination of PorcineFGF-7. This ELISA kit for research use only, not for therapeutic or test applications!<br><br>Principle of the Assay: FGF-7 ELISA kit applies the competitive enzyme immunoassay technique utilizing a polyclonal anti-FGF-7 antibody and an FGF-7-HRP conjugate. The assay sample and buffer are incubated together with FGF-7-HRP conjugate in pre-coated plate for one hour. After the incubation period, the wells are decanted and washed five times. The wells are then incubated with a substrate for HRP enzyme. The product of the enzyme-substrate reaction forms a blue colored complex. Finally, a stop solution is added to stop the reaction, which will then turn the solution yellow. The intensity of color is measured spectrophotometrically at 450nm in a microplate reader. The intensity of the color is inversely proportional to the FGF-7 concentration since FGF-7 from samples and FGF-7-HRP conjugate compete for the anti-FGF-7 antibody binding site. Since the number of sites is limited, as more sites are occupied by FGF-7 from the sample, fewer sites are left to bind FGF-7-HRP conjugate. A standard curve is plotted relating the intensity of the color (O.D.) to the concentration of standards. The FGF-7 concentration in each sample is interpolated from this standard curve.
⇄⧉ncbi_pathways => string (467) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[12]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signal Transduction Pathway||106385!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250!!Downstream Signaling Of Activated FGFR Pathway||160957!!FGFR Ligand Binding And Activation Pathway||106344
⇄⧉search_terms => string (682) "aaa16754 porcine this assay has high sensitivity and excellent specificity f...
$value[12]['_source']['search_terms']
aaa16754 porcine this assay has high sensitivity and excellent specificity for detection of fgf 7 no significant cross reactivity or interference between analogues was observed note limited by current skills knowledge it is impossible us to complete the all therefore reaction may still exist in some cases typical testing data standard curve reference only aaa16754_sc elisa kit fibroblast growth factor fgf7 partial kgf hbgf keratinocyte heparin binding 11,520 da fgf7_human 49456957 cag46799.1 p21781 q6fgv5 q96fg5 h0yny5 148180 signal transduction samples serum plasma cell culture supernatants body fluid tissue homogenate type quantitative competitive 0.1 ng ml competitive0.1
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of F...
$value[13]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGF2. No significant cross-reactivity or interference between FGF2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[13]['_source']['purity']
⇄form => string (3) "N/A"
$value[13]['_source']['form']
⇄concentration => string (3) "N/A"
$value[13]['_source']['concentration']
⇄⧉storage_stability => string (474) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[13]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition.<br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Quantitative Competitive!!Samples||Porcine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids!!Detection Range||12.35-1,000pg/mL!!Sensitivity||< 4.84pg/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[13]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FGF2 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FGF2 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (993) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[13]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. A monoclonal antibody specific to FGF2 has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled FGF2 and unlabeled FGF2 (Standards or samples) with the pre-coated antibody specific to FGF2. After incubation the unbound conjugate is washed off. Next, avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. The amount of bound HRP conjugate is reverse proportional to the concentration of FGF2 in the sample. After addition of the substrate solution, the intensity of color developed is reverse proportional to the concentration of FGF2 in the sample.<br><br>Intended Uses: The kit is a competitive inhibition enzyme immunoassay technique for the in vitro quantitative measurement of FGF2 in porcine serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
⇄products_references => string (3) "N/A"
$value[13]['_source']['products_references']
⇄⧉products_related_diseases => string (216) "Neoplasms||2660!!Nervous System Diseases||973!!Necrosis||601!!Wounds and Inj...
Neoplasms||2660!!Nervous System Diseases||973!!Necrosis||601!!Wounds and Injuries||551!!Inflammation||425!!Heart Diseases||412!!Myocardial Ischemia||342!!Disease Progression||329!!Lung Diseases||310!!Hyperplasia||254
⇄⧉search_terms => string (771) "aaa22808 porcine this assay has high sensitivity and excellent specificity f...
$value[13]['_source']['search_terms']
aaa22808 porcine this assay has high sensitivity and excellent specificity for detection of fgf2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa22808_sc elisa kit fibroblast growth factor 2 basic pig b fgf bfgf fgfb hbgh heparin binding 34 kda isoform hbgf 21,203 da 153285461 np_001997.5 p09038 nm_002006.4 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 x04431 genomic dna samples serum plasma tissue homogenates cell lysates culture supernates other biological fluids type quantitative competitive range 12.35 1,000pg ml < 4.84pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv factor2 binding34 an3 tested20
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of F...
$value[14]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGF5. No significant cross-reactivity or interference between FGF5 and analogues was observed.
⇄purity => string (3) "N/A"
$value[14]['_source']['purity']
⇄form => string (3) "N/A"
$value[14]['_source']['form']
⇄concentration => string (3) "N/A"
$value[14]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[14]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Quantitative Competitive!!Samples||Human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids!!Detection Range||12.35-1,000pg/mL!!Sensitivity||< 4.99pg/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[14]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FGF5 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FGF5 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (991) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[14]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. A monoclonal antibody specific to FGF5 has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled FGF5 and unlabeled FGF5 (Standards or samples) with the pre-coated antibody specific to FGF5. After incubation the unbound conjugate is washed off. Next, avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. The amount of bound HRP conjugate is reverse proportional to the concentration of FGF5 in the sample. After addition of the substrate solution, the intensity of color developed is reverse proportional to the concentration of FGF5 in the sample.<br><br>Intended Uses: The kit is a competitive inhibition enzyme immunoassay technique for the in vitro quantitative measurement of FGF5 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
⇄⧉ncbi_pathways => string (467) "Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pat...
$value[14]['_source']['ncbi_pathways']
Activated Point Mutants Of FGFR2 Pathway||645281!!Adaptive Immune System Pathway||366160!!Constitutive PI3K/AKT Signaling In Cancer Pathway||685535!!DAP12 Interactions Pathway||685549!!DAP12 Signaling Pathway||685550!!Disease Pathway||530764!!Downstream Signal Transduction Pathway||106385!!Downstream Signaling Events Of B Cell Receptor (BCR) Pathway||576250!!Downstream Signaling Of Activated FGFR Pathway||160957!!FGFR Ligand Binding And Activation Pathway||106344
⇄⧉search_terms => string (689) "aaa20615 human this assay has high sensitivity and excellent specificity for...
$value[14]['_source']['search_terms']
aaa20615 human this assay has high sensitivity and excellent specificity for detection of fgf5 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20615_sc elisa kit fibroblast growth factor 5 hbgf tcmgly smag 82 heparin binding 13,006 da fgf fgf5_human 182545 aab06463.1 p12034 o75846 q3y8m3 q8nf90 b2r554 165190 cytokine samples serum plasma tissue homogenates cell lysates culture supernates other biological fluids type quantitative competitive range 12.35 1,000pg ml < 5.32pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv factor5 smag82 an3 tested20
⇄⧉products_description => string (677) "Principle of the Assay: This experiment use double-sandwich elisa technique ...
$value[15]['_source']['products_description']
Principle of the Assay: This experiment use double-sandwich elisa technique and the ELISA Kit provided is typical. The pre-coated antibody is human FGFBP2 monoclonal antibody and the detecting antibody is polyclonal antibody with biotin labeled. Samples and biotin labeling antibody are added into ELISA plate wells and washed out with PBS or TBS. Then Avidin-peroxidase conjugates are added to ELISA wells in order; Use TMB substrate for coloring after reactant thoroughly washed out by PBS or TBS. TMB turns into blue in peroxidase catalytic and finally turns into yellow under the action of acid. The color depth and the testing factors in samples are positively correlated.
⇄⧉search_terms => string (522) "aaa22519 human no cross reaction with other factors typical testing data sta...
$value[15]['_source']['search_terms']
aaa22519 human no cross reaction with other factors typical testing data standard curve for reference only aaa22519_sc elisa kit fibroblast growth factor binding protein 2 fgfbp2 ksp37 hbp17rp fgf bp2 fgfbp hbp17 rp related 37 kda killer specific secretory of 24,581 da unq425 pro1065 fgfp2_human 13994345 np_114156.1 q9byj0 nm_031950.3 607713 samples serum plasma or cell culture supernatant assay type quantitative sandwich detection range 20 ng ml 0.312 sensitivity up to 0.06 intra precision protein2 related37 range20
⇄specificity => string (62) "Recognizes human FGF8. Species Crossreactivity: mouse and rat."
$value[16]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[16]['_source']['purity']
⇄⧉form => string (102) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with hor...
$value[16]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with horseradish peroxidase (HRP).
⇄concentration => string (3) "N/A"
$value[16]['_source']['concentration']
⇄⧉storage_stability => string (537) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[16]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Note: Sodium azide is a potent inhibitor of peroxidase and should not be added to HRP conjugates. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[16]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[16]['_source']['app_notes']
⇄⧉testing_protocols => string (699) "Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/...
$value[16]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.||AAA25393_APP6.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.||AAA25393_WB5.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.||AAA25393_WB4.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.||AAA25393_WB3.jpg!!WB (Western Blot)||FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.||AAA25393_WB2.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.||AAA25393_WB.jpg
⇄⧉etc_term1 => string (238) "Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP...
$value[16]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK!!Conjugate||HRP
⇄⧉products_description => string (285) "Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth ...
$value[16]['_source']['products_description']
Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.
⇄⧉search_terms => string (890) "aaa25393 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affin...
$value[16]['_source']['search_terms']
aaa25393 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with horseradish peroxidase hrp recognizes fgf8 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody analysis of expression pc 12 aaa25393_wb hepg2 aaa25393_wb2 raw 264.7 aaa25393_wb3 jurkat aaa25393_wb4 nih 3t3 aaa25393_wb5 testing data detection limit for recombinant gst tagged is ~0.3ng ml capture aaa25393_td6 fibroblast growth factor 8 fgf androgen induced aigf heparin binding hbgf isoform e hh6 kal6 24kda fgf8_human 15147348 np_149354 p55075 nm_033164 600483 antibodies factors cytokines immunogen partial corresponding to aa65 133 from tag mw the alone 26kd sequence srrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetdtfgsrvrvrgaetglyicmnkkgk conjugate ph7.2 pc12 factor8 aa65133
⇄⧉specificity => string (169) "This assay has high sensitivity and excellent specificity for detection of F...
$value[17]['_source']['specificity']
This assay has high sensitivity and excellent specificity for detection of FGF2. No significant cross-reactivity or interference between FGF2 and analogues was observed.
⇄purity => string (3) "N/A"
$value[17]['_source']['purity']
⇄form => string (3) "N/A"
$value[17]['_source']['form']
⇄concentration => string (3) "N/A"
$value[17]['_source']['concentration']
⇄⧉storage_stability => string (475) "The stability of kit is determined by the loss rate of activity. The loss ra...
$value[17]['_source']['storage_stability']
The stability of kit is determined by the loss rate of activity. The loss rate of this kit is less than 5% within the expiration date under appropriate storage condition. <br>To minimize extra influence on the performance, operation procedures and lab conditions, especially room temperature, air humidity, incubator temperature should be strictly controlled. It is also strongly suggested that the whole assay is performed by the same operator from the beginning to the end.
Assay Type||Quantitative Competitive!!Samples||Human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids!!Detection Range||12.35-1,000pg/mL!!Sensitivity||< 4.43pg/mL
⇄⧉etc_term2 => string (414) "Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 ...
$value[17]['_source']['etc_term2']
Intra-assay Precision||Intra-assay Precision (Precision within an assay): 3 samples with low, middle and high level FGF2 were tested 20 times on one plate, respectively. Intra-Assay: CV<10%!!Inter-assay Precision||Inter-assay Precision (Precision between assays): 3 samples with low, middle and high level FGF2 were tested on 3 different plates, 8 replicates in each plate. CV(%) = SD/meanX100. Inter-Assay: CV<12%
⇄⧉products_description => string (991) "Principle of the Assay: This assay employs the competitive inhibition enzyme...
$value[17]['_source']['products_description']
Principle of the Assay: This assay employs the competitive inhibition enzyme immunoassay technique. A monoclonal antibody specific to FGF2 has been pre-coated onto a microplate. A competitive inhibition reaction is launched between biotin labeled FGF2 and unlabeled FGF2 (Standards or samples) with the pre-coated antibody specific to FGF2. After incubation the unbound conjugate is washed off. Next, avidin conjugated to Horseradish Peroxidase (HRP) is added to each microplate well and incubated. The amount of bound HRP conjugate is reverse proportional to the concentration of FGF2 in the sample. After addition of the substrate solution, the intensity of color developed is reverse proportional to the concentration of FGF2 in the sample.<br><br>Intended Uses: The kit is a competitive inhibition enzyme immunoassay technique for the in vitro quantitative measurement of FGF2 in human serum, plasma, tissue homogenates, cell lysates, cell culture supernates and other biological fluids.
⇄products_references => string (3) "N/A"
$value[17]['_source']['products_references']
⇄⧉products_related_diseases => string (212) "Nervous System Diseases||981!!Necrosis||617!!Wounds and Injuries||571!!Infla...
Nervous System Diseases||981!!Necrosis||617!!Wounds and Injuries||571!!Inflammation||443!!Heart Diseases||419!!Myocardial Ischemia||347!!Disease Progression||339!!Lung Diseases||321!!Hyperplasia||258!!Glioma||226
⇄⧉search_terms => string (773) "aaa20431 human this assay has high sensitivity and excellent specificity for...
$value[17]['_source']['search_terms']
aaa20431 human this assay has high sensitivity and excellent specificity for detection of fgf2 no significant cross reactivity or interference between analogues was observed typical testing data standard curve reference only aaa20431_sc elisa kit fibroblast growth factor 2 basic b fgf bfgf fgfb hbgh heparin binding hbgf 21,203 da fgf2_human 153285461 np_001997.5 p09038 nm_002006.4 o00527 p78443 q16443 q5py50 q7kz11 q7kz72 q9uc54 q9ucs5 q9ucs6 a4lbb8 134920 cytokine tumor immunity infection samples serum plasma tissue homogenates cell lysates culture supernates other biological fluids type quantitative competitive range 12.35 1,000pg ml < 5.16pg intra precision within an 3 with low middle level were tested 20 times on one plate respectively cv factor2 an3 tested20
⇄specificity => string (62) "Recognizes human FGF8. Species Crossreactivity: mouse and rat."
$value[18]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[18]['_source']['purity']
⇄⧉form => string (107) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Flu...
$value[18]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
⇄concentration => string (3) "N/A"
$value[18]['_source']['concentration']
⇄⧉storage_stability => string (488) "Store product at 4 degree C if to be used immediately within two weeks. For ...
$value[18]['_source']['storage_stability']
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[18]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[18]['_source']['app_notes']
⇄⧉testing_protocols => string (699) "Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/...
$value[18]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.||AAA25099_APP6.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.||AAA25099_WB5.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.||AAA25099_WB4.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.||AAA25099_WB3.jpg!!WB (Western Blot)||FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.||AAA25099_WB2.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.||AAA25099_WB.jpg
⇄⧉etc_term1 => string (239) "Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP...
$value[18]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK!!Conjugate||FITC
⇄⧉products_description => string (285) "Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth ...
$value[18]['_source']['products_description']
Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.
⇄⧉search_terms => string (895) "aaa25099 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affin...
$value[18]['_source']['search_terms']
aaa25099 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with fluorescein isothiocyanate fitc recognizes fgf8 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody analysis of expression pc 12 aaa25099_wb hepg2 aaa25099_wb2 raw 264.7 aaa25099_wb3 jurkat aaa25099_wb4 nih 3t3 aaa25099_wb5 testing data detection limit for recombinant gst tagged is ~0.3ng ml capture aaa25099_td6 fibroblast growth factor 8 fgf androgen induced aigf heparin binding hbgf isoform e hh6 kal6 24kda fgf8_human 15147348 np_149354 p55075 nm_033164 600483 antibodies factors cytokines immunogen partial corresponding to aa65 133 from tag mw the alone 26kd sequence srrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetdtfgsrvrvrgaetglyicmnkkgk conjugate ph7.2 pc12 factor8 aa65133
⇄specificity => string (62) "Recognizes human FGF8. Species Crossreactivity: mouse and rat."
$value[19]['_source']['specificity']
⇄purity => string (46) "Purified by Protein A Affinity Chromatography."
$value[19]['_source']['purity']
⇄⧉form => string (94) "Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-P...
$value[19]['_source']['form']
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
⇄concentration => string (3) "N/A"
$value[19]['_source']['concentration']
⇄⧉storage_stability => string (363) "Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C...
$value[19]['_source']['storage_stability']
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.
⇄app_tested => string (30) "ELISA (EIA), Western Blot (WB)"
$value[19]['_source']['app_tested']
⇄app_notes => string (48) "Applications are based on unconjugated antibody."
$value[19]['_source']['app_notes']
⇄⧉testing_protocols => string (699) "Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/...
$value[19]['_source']['testing_protocols']
Application Data||Detection limit for recombinant GST tagged FGF8 is ~0.3ng/ml as a capture antibody.||AAA25688_APP6.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in NIH/3T3.||AAA25688_WB5.jpg!!WB (Western Blot)||FGF8 monoclonal antibody Western Blot analysis of FGF8 expression in Jurkat.||AAA25688_WB4.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in Raw 264.7.||AAA25688_WB3.jpg!!WB (Western Blot)||FGF8 monoclonal antibody, Western Blot analysis of FGF8 expression in HepG2.||AAA25688_WB2.jpg!!WB (Western Blot)||FGF8 monoclonal antibody. Western Blot analysis of FGF8 expression in PC-12.||AAA25688_WB.jpg
⇄⧉etc_term1 => string (237) "Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP...
$value[19]['_source']['etc_term1']
Immunogen||Partial recombinant corresponding to aa65-133 from human FGF8 (NP_149354) with GST tag. MW of the GST tag alone is 26kD.!!Immunogen Sequence||SRRLIRTYQLYSRTSGKHVQVLANKRINAMAEDGDPFAKLIVETDTFGSRVRVRGAETGLYICMNKKGK!!Conjugate||PE
⇄⧉products_description => string (285) "Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth ...
$value[19]['_source']['products_description']
Fibroblast Growth Factor-8 (FGF-8) is also known as Androgen-induced Growth Factor (AIGF), a heparin binding growth factor, which stimulates the proliferation and activation of cells that express the FGF receptors. Recombinant human FGF-8 is a 22.4kD protein containing 193aa residues.
⇄⧉search_terms => string (882) "aaa25688 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affin...
$value[19]['_source']['search_terms']
aaa25688 mouse human rat monoclonal igg2a,k 2a10 purified by protein a affinity chromatography supplied as liquid in pbs ph 7.2 no preservative added labeled with r phycoerythrin pe recognizes fgf8 species crossreactivity and elisa eia western blot wb applications are based on unconjugated antibody analysis of expression pc 12 aaa25688_wb hepg2 aaa25688_wb2 raw 264.7 aaa25688_wb3 jurkat aaa25688_wb4 nih 3t3 aaa25688_wb5 testing data detection limit for recombinant gst tagged is ~0.3ng ml capture aaa25688_td6 fibroblast growth factor 8 fgf androgen induced aigf heparin binding hbgf isoform e hh6 kal6 24kda fgf8_human 15147348 np_149354 p55075 nm_033164 600483 antibodies factors cytokines immunogen partial corresponding to aa65 133 from tag mw the alone 26kd sequence srrlirtyqlysrtsgkhvqvlankrinamaedgdpfaklivetdtfgsrvrvrgaetglyicmnkkgk conjugate ph7.2 pc12 factor8 aa65133
