Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody. Lane 1: FZD5 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Mouse anti-Human FZD5 Monoclonal Antibody | anti-FZD5 antibody

FZD5 (Frizzled-5, Fz-5, hFz5, FzE5, C2orf31, DKFZp434E2135, MGC129692) (PE)

Gene Names
FZD5; HFZ5; C2orf31
Reactivity
Human
Applications
ELISA, Immunoprecipitation, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FZD5; Monoclonal Antibody; FZD5 (Frizzled-5; Fz-5; hFz5; FzE5; C2orf31; DKFZp434E2135; MGC129692) (PE); anti-FZD5 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
6A3
Specificity
Recognizes human FZD5.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FZD5 antibody
ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa72-162 from FZD5 (NP_003459) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR*
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody. Lane 1: FZD5 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody. Lane 1: FZD5 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of FZD5 transfected lysate using FZD5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FZD5 rabbit polyclonal antibody.)

Immunoprecipitation (IP) (Immunoprecipitation of FZD5 transfected lysate using FZD5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FZD5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged FZD5 is ~0.3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FZD5 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between WNT5A and FZD5 HeLa cells were stained with WNT5A rabbit purified polyclonal 1:1200 and FZD5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between WNT5A and FZD5 HeLa cells were stained with WNT5A rabbit purified polyclonal 1:1200 and FZD5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-FZD5 antibody
Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.
Product Categories/Family for anti-FZD5 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
62kDa
NCBI Official Full Name
frizzled-5
NCBI Official Synonym Full Names
frizzled class receptor 5
NCBI Official Symbol
FZD5
NCBI Official Synonym Symbols
HFZ5; C2orf31
NCBI Protein Information
frizzled-5
UniProt Protein Name
Frizzled-5
Protein Family
UniProt Gene Name
FZD5
UniProt Synonym Gene Names
C2orf31; Fz-5; hFz5

NCBI Description

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

Uniprot Description

Receptor for Wnt proteins (PubMed:9054360, PubMed:10097073, PubMed:20530549). Can activate WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo situation may be different since not all of these are known to be coexpressed (). In neurons, activation of WNT7A promotes formation of synapses (PubMed:20530549). Functions in the canonical Wnt/beta-catenin signaling pathway. The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable). Plays a role in yolk sac angiogenesis and in placental vascularization ().

Research Articles on FZD5

Similar Products

Product Notes

The FZD5 fzd5 (Catalog #AAA6157900) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FZD5 (Frizzled-5, Fz-5, hFz5, FzE5, C2orf31, DKFZp434E2135, MGC129692) (PE) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FZD5 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FZD5 fzd5 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FZD5, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.