Mouse anti-Human FZD5 Monoclonal Antibody | anti-FZD5 antibody

FZD5 (Frizzled-5, Fz-5, hFz5, FzE5, C2orf31, DKFZp434E2135, MGC129692) (PE)

Cat. Num. AAA6157900

• Gene Names: FZD5; HFZ5; C2orf31
• Reactivity: Human
• Applications: ELISA, Immunoprecipitation, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FZD5; Monoclonal Antibody; FZD5 (Frizzled-5; Fz-5; hFz5; FzE5; C2orf31; DKFZp434E2135; MGC129692) (PE); anti-FZD5 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG2a,k
• Clone Number: 6A3
• Specificity: Recognizes human FZD5.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).

• Applicable Applications for anti-FZD5 antibody: ELISA (EIA), Immunoprecipitation (IP), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa72-162 from FZD5 (NP_003459) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: PLVEIQCSPDLRFFLCSMYTPICLPDYHKPLPPCRSVCERAKAGCSPLMRQYGFAWPERMSCDRLPVLGRDAEVLCMDYNRSEATTAPPR*
• Conjugate: PE
• Preparation and Storage: Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot analysis of FZD5 expression in transfected 293T cell line by FZD5 monoclonal antibody. Lane 1: FZD5 transfected lysate (64.5kD). Lane 2: Non-transfected lysate.)

Immunoprecipitation (IP)

(Immunoprecipitation of FZD5 transfected lysate using FZD5 monoclonal antibody and Protein A Magnetic Bead and immunoblotted with FZD5 rabbit polyclonal antibody.)

Testing Data

(Detection limit for recombinant GST tagged FZD5 is ~0.3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between WNT5A and FZD5 HeLa cells were stained with WNT5A rabbit purified polyclonal 1:1200 and FZD5 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Related Product Information for anti-FZD5 antibody

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand.

Product Categories/Family for anti-FZD5 antibody

Antibodies; Cancer Markers

NCBI and Uniprot Product Information

• NCBI GI #: 27894385
• NCBI GeneID: 7855
• NCBI Accession #: NP_003459
• NCBI GenBank Nucleotide #: NM_003468
• UniProt Accession #: Q13467
• Molecular Weight: 62kDa
• NCBI Official Full Name: frizzled-5
• NCBI Official Synonym Full Names: frizzled class receptor 5
• NCBI Official Symbol: FZD5
• NCBI Official Synonym Symbols: HFZ5; C2orf31
• NCBI Protein Information: frizzled-5
• UniProt Protein Name: Frizzled-5
• Protein Family: Frizzled
• UniProt Gene Name: FZD5
• UniProt Synonym Gene Names: C2orf31; Fz-5; hFz5

NCBI Description

Members of the 'frizzled' gene family encode 7-transmembrane domain proteins that are receptors for Wnt signaling proteins. The FZD5 protein is believed to be the receptor for the Wnt5A ligand. [provided by RefSeq, Jul 2008]

Uniprot Description

Receptor for Wnt proteins (PubMed:9054360, PubMed:10097073, PubMed:20530549). Can activate WNT2, WNT10B, WNT5A, but not WNT2B or WNT4 (in vitro); the in vivo situation may be different since not all of these are known to be coexpressed (). In neurons, activation of WNT7A promotes formation of synapses (PubMed:20530549). Functions in the canonical Wnt/beta-catenin signaling pathway. The canonical Wnt/beta-catenin signaling pathway leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes (). A second signaling pathway involving PKC and calcium fluxes has been seen for some family members, but it is not yet clear if it represents a distinct pathway or if it can be integrated in the canonical pathway, as PKC seems to be required for Wnt-mediated inactivation of GSK-3 kinase. Both pathways seem to involve interactions with G-proteins. May be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues (Probable). Plays a role in yolk sac angiogenesis and in placental vascularization ().