Mouse anti-Human FVT1 Monoclonal Antibody | anti-FVT1 antibody

FVT1 (Follicular Variant Translocation Protein 1, FVT-1, 3-dehydrosphinganine Reductase, DHSR, 3-ketodihydrosphingosine Reductase, KDS Reductase, KDSR, FLJ36555, FLJ92680, SDR35C1) (AP)

Cat. Num. AAA6131378

• Gene Names: KDSR; DHSR; FVT1; SDR35C1
• Reactivity: Human
• Applications: ELISA, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FVT1; Monoclonal Antibody; FVT1 (Follicular Variant Translocation Protein 1; FVT-1; 3-dehydrosphinganine Reductase; DHSR; 3-ketodihydrosphingosine Reductase; KDS Reductase; KDSR; FLJ36555; FLJ92680; SDR35C1) (AP); anti-FVT1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 2B2-3C11
• Specificity: Recognizes human FVT1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Alkaline Phosphatase (AP).

• Applicable Applications for anti-FVT1 antibody: ELISA (EIA), Western Blot (WB)
• Application Notes: Applications are based on unconjugated antibody.
• Immunogen: Full length recombinant corresponding to aa1-332 from human FVT1 (AAH08797.1) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: FVLLLYMVSPLISPKPLALPGAHVVVTGGSSGIGKCIAIECYKQGAFITLVARNEDKLLQAKKEIEMHSINDKQVVLCISVDVSQDYNQVENVIKQAQEKLGPVDMLVNCAGMAVSGKFEDLEVSTFERLMSINYLGSVYPSRAVITTMKERRVGRIVFVSSQAGQLGLFGFTAYSASKFAIRGLAEALQMEVKPYNVYITVAYPPDTDTPGFAEENRTKPLETRLISETTSVCKPEQVAKQIVKDAIQGNFNSSLGSDGYMLSALTCGMAPVTSITEGLQQVVTMGLFRTIALFYLGSFDSIVRRCMMQREKSENADKTA
• Conjugate: AP
• Preparation and Storage: Store product at 4 degree C. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (61.05kD).)

Western Blot (WB)

(FVT1 monoclonal antibody, Western Blot analysis of FVT1 expression in Jurkat.)

Testing Data

(Detection limit for recombinant GST tagged FVT1 is ~1ng/ml as a capture antibody.)

Related Product Information for anti-FVT1 antibody

FVT1 catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving its gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy.

Product Categories/Family for anti-FVT1 antibody

Antibodies; Enzymes

NCBI and Uniprot Product Information

• NCBI GI #: 33873993
• NCBI GeneID: 2531
• Molecular Weight: 29,159 Da
• NCBI Official Full Name: Homo sapiens 3-ketodihydrosphingosine reductase, mRNA
• NCBI Official Synonym Full Names: 3-ketodihydrosphingosine reductase
• NCBI Official Symbol: KDSR
• NCBI Official Synonym Symbols: DHSR; FVT1; SDR35C1
• NCBI Protein Information: 3-ketodihydrosphingosine reductase; 3-dehydrosphinganine reductase; FVT-1; KDS reductase; follicular lymphoma variant translocation 1; follicular variant translocation protein 1; short chain dehydrogenase/reductase family 35C, member 1

NCBI Description

The protein encoded by this gene catalyzes the reduction of 3-ketodihydrosphingosine to dihydrosphingosine. The putative active site residues of the encoded protein are found on the cytosolic side of the endoplasmic reticulum membrane. A chromosomal rearrangement involving this gene is a cause of follicular lymphoma, also known as type II chronic lymphatic leukemia. The mutation of a conserved residue in the bovine ortholog causes spinal muscular atrophy. [provided by RefSeq, Jul 2008]