Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.)

Mouse FUT7 Monoclonal Antibody | anti-FUT7 antibody

FUT7 (Fucosyltransferase 7 (alpha (1,3) Fucosyltransferase), FucT-VII) (PE)

Gene Names
FUT7; FucT-VII
Applications
ELISA
Purity
Purified
Synonyms
FUT7; Monoclonal Antibody; FUT7 (Fucosyltransferase 7 (alpha (1; 3) Fucosyltransferase); FucT-VII) (PE); Fucosyltransferase 7 (alpha (1; FucT-VII; anti-FUT7 antibody
Ordering
For Research Use Only!
Host
Mouse
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
1A12
Specificity
Recognizes FUT7.
Purity/Purification
Purified
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with R-Phycoerythrin (PE).
Applicable Applications for anti-FUT7 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
FUT7 (NP_004470, 262aa-342aa) partial recombinant protein with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
YEAFVPADAFVHVDDFGSARELAAFLTGMNESRYQRFFAWRDRLRVRLFTDWRERFCAICDRYPHLPRSQVYEDLEGWFQA
Conjugate
PE
Preparation and Storage
Store product at 4 degree C in the dark. DO NOT FREEZE! Stable at 4 degree C for 12 months after receipt as an undiluted liquid. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: PE conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FUT7 is approximately 0.1ng/ml as a capture antibody.)
Related Product Information for anti-FUT7 antibody
The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq]
Product Categories/Family for anti-FUT7 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
37.9 kDa (329aa)
NCBI Official Full Name
alpha-(1,3)-fucosyltransferase 7
NCBI Official Synonym Full Names
fucosyltransferase 7
NCBI Official Symbol
FUT7
NCBI Official Synonym Symbols
FucT-VII
NCBI Protein Information
alpha-(1,3)-fucosyltransferase 7
UniProt Protein Name
Alpha-(1,3)-fucosyltransferase 7
UniProt Gene Name
FUT7
UniProt Synonym Gene Names
FucT-VII

NCBI Description

The protein encoded by this gene is a Golgi stack membrane protein that is involved in the creation of sialyl-Lewis X antigens. The encoded protein can direct the synthesis of the E-selectin-binding sialyl-Lewis X moiety. [provided by RefSeq, Jul 2008]

Uniprot Description

Catalyzes alpha-1,3 glycosidic linkages involved in the expression of sialyl Lewis X antigens.

Research Articles on FUT7

Similar Products

Product Notes

The FUT7 fut7 (Catalog #AAA6184246) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. AAA Biotech's FUT7 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FUT7 fut7 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FUT7, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.