Mouse anti-Human FUSIP1 Monoclonal Antibody | anti-FUSIP1 antibody

FUSIP1 (SRSF10, FUSIP1, FUSIP2, SFRS13A, TASR, Serine/Arginine-rich Splicing Factor 10, 40kD SR-repressor Protein, FUS-interacting Serine-arginine-rich Protein 1, Splicing Factor SRp38, Splicing Factor, Arginine/Serine-rich 13A, TLS-associated Protein wit

Cat. Num. AAA6147284

• Gene Names: SRSF10; NSSR; TASR; SRp38; TASR1; TASR2; FUSIP1; FUSIP2; SFRS13; SRrp40; SFRS13A; PPP1R149
• Reactivity: Human
• Applications: ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
• Purity: Purified by Protein A Affinity Chromatography.
• Synonyms: FUSIP1; Monoclonal Antibody; FUSIP1 (SRSF10; FUSIP2; SFRS13A; TASR; Serine/Arginine-rich Splicing Factor 10; 40kD SR-repressor Protein; FUS-interacting Serine-arginine-rich Protein 1; Splicing Factor SRp38; Splicing Factor; Arginine/Serine-rich 13A; TLS-associated Protein wit; anti-FUSIP1 antibody

• Host: Mouse
• Reactivity: Human
• Clonality: Monoclonal
• Isotype: IgG1,k
• Clone Number: 1A6
• Specificity: Recognizes human FUSIP1.
• Purity/Purification: Purified by Protein A Affinity Chromatography.
• Form/Format: Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
• Sequence Length: 1633

• Applicable Applications for anti-FUSIP1 antibody: ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
• Application Notes: IF: 10ug/ml; Applications are based on unconjugated antibody.
• Immunogen: Partial recombinant corresponding to aa1-100 from human FUSIP1 (AAH05039) with GST tag. MW of the GST tag alone is 26kD.
• Immunogen Sequence: MSRYLRPPNTSLFVRNVADDTRSEDLRREFGRYGPIVDVYVPLDFYTRRPRGFAYVQFEDVRDAEDALHNLDRKWICGRQIEIQFAQGDRKTPNQMKAKE
• Conjugate: FITC
• Preparation and Storage: Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (37.11kD).)

Western Blot (WB)

(Western Blot analysis of FUSIP1 expression in transfected 293T cell line by FUSIP1 monoclonal antibody Lane 1: FUSIP1 transfected lysate (22.2kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FUSIP1 on formalin-fixed paraffin-embedded human testis. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FUSIP1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FUSIP1 is ~0.1ng/ml as a capture antibody.)

Western Blot (WB)

(FUSIP1 monoclonal antibody Western Blot analysis of FUSIP1 expression in Hela NE.)

Product Categories/Family for anti-FUSIP1 antibody

Antibodies; Splicing Factors

NCBI and Uniprot Product Information

• NCBI GI #: 13477158
• NCBI GeneID: 10772
• NCBI Official Full Name: Homo sapiens FUS interacting protein (serine/arginine-rich) 1, mRNA
• NCBI Official Synonym Full Names: serine and arginine rich splicing factor 10
• NCBI Official Symbol: SRSF10
• NCBI Official Synonym Symbols: NSSR; TASR; SRp38; TASR1; TASR2; FUSIP1; FUSIP2; SFRS13; SRrp40; SFRS13A; PPP1R149
• NCBI Protein Information: serine/arginine-rich splicing factor 10

NCBI Description

This gene product is a member of the serine-arginine (SR) family of proteins, which are involved in constitutive and regulated RNA splicing. Members of this family are characterized by N-terminal RNP1 and RNP2 motifs, which are required for binding to RNA, and multiple C-terminal SR/RS repeats, which are important in mediating association with other cellular proteins. This protein interacts with the oncoprotein TLS, and abrogates the influence of TLS on adenovirus E1A pre-mRNA splicing. This gene has pseudogenes on chromosomes 4, 9, 14, 18, and 20. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jul 2014]