Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Mouse anti-Human FUBP1 Monoclonal Antibody | anti-FUBP1 antibody

FUBP1 (Far Upstream Element-binding Protein 1, DNA Helicase V, FBP, FUSE-binding Protein 1, hDH V) (FITC)

Gene Names
FUBP1; FBP; FUBP; hDH V
Reactivity
Human
Applications
ELISA, Immunofluorescence, Immunohistochemistry, Western Blot
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FUBP1; Monoclonal Antibody; FUBP1 (Far Upstream Element-binding Protein 1; DNA Helicase V; FBP; FUSE-binding Protein 1; hDH V) (FITC); anti-FUBP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG2a,k
Clone Number
3H4
Specificity
Recognizes human FUBP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FUBP1 antibody
ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB)
Application Notes
IF: 10ug/ml
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa27-137 from FUBP1 (NP_003893) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
VNDAFKDALQRARQIAAKIGGDAGTSLNSNDYGYGGQKRPLEDGDQPDAKKVAPQNDSFGTQLPPMHQQQSRSVMTEEYKVPDGMVGFIIGRGGEQISRIQQESGCKIQI
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Western Blot (WB)

(Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB) (Western Blot detection against Immunogen (38.21kD).)

Western Blot (WB)

(Western Blot analysis of FUBP1 expression in transfected 293T cell line by FUBP1 monoclonal antibody Lane 1: FUBP1 transfected lysate (68.6kD). Lane 2: Non-transfected lysate.)

Western Blot (WB) (Western Blot analysis of FUBP1 expression in transfected 293T cell line by FUBP1 monoclonal antibody Lane 1: FUBP1 transfected lysate (68.6kD). Lane 2: Non-transfected lysate.)

Immunohistochemistry (IHC)

(Immunoperoxidase of monoclonal antibody to FUBP1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunohistochemistry (IHC) (Immunoperoxidase of monoclonal antibody to FUBP1 on formalin-fixed paraffin-embedded human placenta. [antibody concentration 3ug/ml].)

Immunofluorescence (IF)

(Immunofluorescence of monoclonal antibody to FUBP1 on HeLa cell. [antibody concentration 10ug/ml].)

Immunofluorescence (IF) (Immunofluorescence of monoclonal antibody to FUBP1 on HeLa cell. [antibody concentration 10ug/ml].)

Testing Data

(Detection limit for recombinant GST tagged FUBP1 is ~0.03ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FUBP1 is ~0.03ng/ml as a capture antibody.)
Product Categories/Family for anti-FUBP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
68,605 Da
NCBI Official Full Name
far upstream element-binding protein 1 isoform 2
NCBI Official Synonym Full Names
far upstream element binding protein 1
NCBI Official Symbol
FUBP1
NCBI Official Synonym Symbols
FBP; FUBP; hDH V
NCBI Protein Information
far upstream element-binding protein 1
UniProt Protein Name
Far upstream element-binding protein 1
UniProt Gene Name
FUBP1
UniProt Synonym Gene Names
FBP; FUSE-binding protein 1; hDH V
UniProt Entry Name
FUBP1_HUMAN

NCBI Description

The protein encoded by this gene is a single stranded DNA-binding protein that binds to multiple DNA elements, including the far upstream element (FUSE) located upstream of c-myc. Binding to FUSE occurs on the non-coding strand, and is important to the regulation of c-myc in undifferentiated cells. This protein contains three domains, an amphipathic helix N-terminal domain, a DNA-binding central domain, and a C-terminal transactivation domain that contains three tyrosine-rich motifs. The N-terminal domain is thought to repress the activity of the C-terminal domain. This protein is also thought to bind RNA, and contains 3'-5' helicase activity with in vitro activity on both DNA-DNA and RNA-RNA duplexes. Aberrant expression of this gene has been found in malignant tissues, and this gene is important to neural system and lung development. Binding of this protein to viral RNA is thought to play a role in several viral diseases, including hepatitis C and hand, foot and mouth disease. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Dec 2014]

Uniprot Description

FBP1: Regulates MYC expression by binding to a single-stranded far-upstream element (FUSE) upstream of the MYC promoter. May act both as activator and repressor of transcription. 2 isoforms of the human protein are produced by alternative splicing.

Protein type: RNA splicing; Motility/polarity/chemotaxis; RNA-binding; Transcription factor; DNA-binding

Chromosomal Location of Human Ortholog: 1p31.1

Cellular Component: nucleoplasm; nucleus

Molecular Function: protein binding; transcription factor activity; single-stranded DNA binding

Biological Process: transcription from RNA polymerase II promoter; positive regulation of transcription from RNA polymerase II promoter

Research Articles on FUBP1

Similar Products

Product Notes

The FUBP1 fubp1 (Catalog #AAA6147278) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FUBP1 (Far Upstream Element-binding Protein 1, DNA Helicase V, FBP, FUSE-binding Protein 1, hDH V) (FITC) reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FUBP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA), Immunofluorescence (IF), Immunohistochemistry (IHC), Western Blot (WB). IF: 10ug/ml Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FUBP1 fubp1 for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FUBP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.