Loading...

Skip to main content

Call us on + 1 (800) 604-9114 for more information about our products

Looking for specific datasheet Manual/COA/MSDS?
Request a Manual/COA/MSDS

Interested to get a quote about our products?
Request a Quote

Testing Data (Detection limit for recombinant GST tagged FRAP1 is ~3ng/ml as a capture antibody.)

Mouse anti-Human FRAP1 Monoclonal Antibody | anti-FRAP1 antibody

FRAP1 (Serine/Threonine-protein Kinase mTOR, Mechanistic Target Of Rapamycin, FK506-binding Protein 12-rapamycin Complex-associated Protein 1, FKBP12-rapamycin Complex-associated Protein, Rapamycin Target Protein 1, RAPT1, Mammalian Target Of Rapamycin, m

Gene Names
MTOR; FRAP; FRAP1; FRAP2; RAFT1; RAPT1
Reactivity
Human
Applications
ELISA
Purity
Purified by Protein A Affinity Chromatography.
Synonyms
FRAP1; Monoclonal Antibody; FRAP1 (Serine/Threonine-protein Kinase mTOR; Mechanistic Target Of Rapamycin; FK506-binding Protein 12-rapamycin Complex-associated Protein 1; FKBP12-rapamycin Complex-associated Protein; Rapamycin Target Protein 1; RAPT1; Mammalian Target Of Rapamycin; m; anti-FRAP1 antibody
Ordering
For Research Use Only!
Host
Mouse
Reactivity
Human
Clonality
Monoclonal
Isotype
IgG1,k
Clone Number
2C5
Specificity
Recognizes human FRAP1.
Purity/Purification
Purified by Protein A Affinity Chromatography.
Form/Format
Supplied as a liquid in PBS, pH 7.2. No preservative added. Labeled with Fluorescein isothiocyanate (FITC).
Applicable Applications for anti-FRAP1 antibody
ELISA (EIA)
Application Notes
Applications are based on unconjugated antibody.
Immunogen
Partial recombinant corresponding to aa1521-1620 from human FRAP1 (NP_004949) with GST tag. MW of the GST tag alone is 26kD.
Immunogen Sequence
WGLGQWDSMEEYTCMIPRDTHDGAFYRAVLALHQDLFSLAQQCIDKARDLLDAELTAMAGESYSRAYGAMVSCHMLSELEEVIQYKLVPERREIIRQIWW
Conjugate
FITC
Preparation and Storage
Store product at 4 degree C if to be used immediately within two weeks. For long-term storage, aliquot to avoid repeated freezing and thawing and store at -20 degree C. Aliquots are stable at -20 degree C for 12 months after receipt. Dilute required amount only prior to immediate use. Further dilutions can be made in assay buffer. Caution: FITC conjugates are sensitive to light. For maximum recovery of product, centrifuge the original vial after thawing and prior to removing the cap.

Testing Data

(Detection limit for recombinant GST tagged FRAP1 is ~3ng/ml as a capture antibody.)

Testing Data (Detection limit for recombinant GST tagged FRAP1 is ~3ng/ml as a capture antibody.)

Testing Data

(Proximity Ligation Analysis (PLA) of protein-protein interactions between AKT1 and FRAP1 HeLa cells were stained with AKT1 rabbit purified polyclonal 1:1200 and FRAP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)

Testing Data (Proximity Ligation Analysis (PLA) of protein-protein interactions between AKT1 and FRAP1 HeLa cells were stained with AKT1 rabbit purified polyclonal 1:1200 and FRAP1 mouse monoclonal antibody 1:50. Signals were detected by 30 Detection Kit 613 (red), and nuclei were counterstained with DAPI (blue). Each red dot represents the detection of protein-protein interaction complex.)
Related Product Information for anti-FRAP1 antibody
FRAP1 belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. FRAP1 is a part of the TORC2 complex which plays a critical role in AKT1 Ser-473 phosphorylation, and may modulate the phosphorylation of PKCA and regulate actin cytoskeleton organization.
Product Categories/Family for anti-FRAP1 antibody

NCBI and Uniprot Product Information

NCBI GI #
NCBI GeneID
NCBI Accession #
NCBI GenBank Nucleotide #
UniProt Accession #
Molecular Weight
288,892 Da
NCBI Official Full Name
serine/threonine-protein kinase mTOR
NCBI Official Synonym Full Names
mechanistic target of rapamycin (serine/threonine kinase)
NCBI Official Symbol
MTOR
NCBI Official Synonym Symbols
FRAP; FRAP1; FRAP2; RAFT1; RAPT1
NCBI Protein Information
serine/threonine-protein kinase mTOR; rapamycin target protein 1; mammalian target of rapamycin; rapamycin and FKBP12 target 1; FKBP-rapamycin associated protein; rapamycin associated protein FRAP2; FKBP12-rapamycin complex-associated protein 1; FK506 bin
UniProt Protein Name
Serine/threonine-protein kinase mTOR
UniProt Gene Name
MTOR
UniProt Synonym Gene Names
FRAP; FRAP1; FRAP2; RAFT1; RAPT1; mTOR
UniProt Entry Name
MTOR_HUMAN

NCBI Description

The protein encoded by this gene belongs to a family of phosphatidylinositol kinase-related kinases. These kinases mediate cellular responses to stresses such as DNA damage and nutrient deprivation. This protein acts as the target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. The ANGPTL7 gene is located in an intron of this gene. [provided by RefSeq, Sep 2008]

Uniprot Description

mTOR: an atypical kinase belonging to the PIKK family of kinases. Is the catalytic subunit of two protein complexes, mTORC1 and mTORC2. mTORC1 activates S6K and inactivates 4E-BP1, up-regulating protein synthesis. mTORC1 contains Raptor, a positive regulatory subunit and scaffold for recruiting substrates, two negative regulators, PRAS40 and DEPTOR, and mLST8; it is a target for the cell-cycle arrest and immunosuppressive effects of the FKBP12-rapamycin complex. mTORC2, a downstream effector of PI3K, is insensitive to rapamycin and activates Akt by phosphorylating a key activation site. mTORC2 contains regulatory subunits Rictor and mSIN1, PROTOR, mLST8, and the negative regulator DEPTOR. mTORC1 suppresses PI3K activity via a strong negative feedback loop that involves S6K1. Inhibiting mTORC1 ablates this negative feedback loop and potentiates PI3K signaling. Known inhibitors of mTOR include rapamycin, temsirolimus (CCI-779).

Protein type: Autophagy; Kinase, protein; EC 2.7.11.1; Motility/polarity/chemotaxis; Protein kinase, Ser/Thr (non-receptor); Protein kinase, atypical; ATYPICAL group; PIKK family; FRAP subfamily

Chromosomal Location of Human Ortholog: 1p36.2

Cellular Component: endoplasmic reticulum membrane; PML body; lysosomal membrane; lysosome; dendrite; endomembrane system; cytosol; nucleoplasm; Golgi membrane; mitochondrial outer membrane; membrane; cell soma; cytoplasm; TORC2 complex; nucleus; phosphoinositide 3-kinase complex

Molecular Function: protein dimerization activity; protein domain specific binding; protein serine/threonine kinase activity; protein binding; ribosome binding; phosphoprotein binding; kinase activity; drug binding; ATP binding

Biological Process: negative regulation of autophagy; regulation of myelination; TOR signaling pathway; positive regulation of translation; nerve growth factor receptor signaling pathway; protein amino acid autophosphorylation; regulation of glycogen biosynthetic process; negative regulation of cell size; signal transduction; protein amino acid phosphorylation; germ cell development; negative regulation of macroautophagy; cellular response to nutrient levels; positive regulation of stress fiber formation; regulation of carbohydrate utilization; response to stress; protein catabolic process; cell growth; regulation of response to food; response to nutrient; epidermal growth factor receptor signaling pathway; phosphoinositide-mediated signaling; fibroblast growth factor receptor signaling pathway; peptidyl-threonine phosphorylation; positive regulation of lipid biosynthetic process; negative regulation of NFAT protein import into nucleus; response to amino acid stimulus; double-strand break repair via homologous recombination; positive regulation of protein kinase B signaling cascade; positive regulation of peptidyl-tyrosine phosphorylation; peptidyl-serine phosphorylation; positive regulation of actin filament polymerization; regulation of actin cytoskeleton organization and biogenesis; T cell costimulation; insulin receptor signaling pathway; ruffle organization and biogenesis; innate immune response; regulation of fatty acid beta-oxidation; positive regulation of transcription from RNA polymerase III promoter; positive regulation of endothelial cell proliferation; positive regulation of protein amino acid phosphorylation; vascular endothelial growth factor receptor signaling pathway; regulation of protein kinase activity; phosphorylation; growth

Research Articles on FRAP1

Similar Products

Product Notes

The FRAP1 mtor (Catalog #AAA6147269) is an Antibody produced from Mouse and is intended for research purposes only. The product is available for immediate purchase. The FRAP1 (Serine/Threonine-protein Kinase mTOR, Mechanistic Target Of Rapamycin, FK506-binding Protein 12-rapamycin Complex-associated Protein 1, FKBP12-rapamycin Complex-associated Protein, Rapamycin Target Protein 1, RAPT1, Mammalian Target Of Rapamycin, m reacts with Human and may cross-react with other species as described in the data sheet. AAA Biotech's FRAP1 can be used in a range of immunoassay formats including, but not limited to, ELISA (EIA). Applications are based on unconjugated antibody. Researchers should empirically determine the suitability of the FRAP1 mtor for an application not listed in the data sheet. Researchers commonly develop new applications and it is an integral, important part of the investigative research process. It is sometimes possible for the material contained within the vial of "FRAP1, Monoclonal Antibody" to become dispersed throughout the inside of the vial, particularly around the seal of said vial, during shipment and storage. We always suggest centrifuging these vials to consolidate all of the liquid away from the lid and to the bottom of the vial prior to opening. Please be advised that certain products may require dry ice for shipping and that, if this is the case, an additional dry ice fee may also be required.

Precautions

All products in the AAA Biotech catalog are strictly for research-use only, and are absolutely not suitable for use in any sort of medical, therapeutic, prophylactic, in-vivo, or diagnostic capacity. By purchasing a product from AAA Biotech, you are explicitly certifying that said products will be properly tested and used in line with industry standard. AAA Biotech and its authorized distribution partners reserve the right to refuse to fulfill any order if we have any indication that a purchaser may be intending to use a product outside of our accepted criteria.

Disclaimer

Though we do strive to guarantee the information represented in this datasheet, AAA Biotech cannot be held responsible for any oversights or imprecisions. AAA Biotech reserves the right to adjust any aspect of this datasheet at any time and without notice. It is the responsibility of the customer to inform AAA Biotech of any product performance issues observed or experienced within 30 days of receipt of said product. To see additional details on this or any of our other policies, please see our Terms & Conditions page.

Item has been added to Shopping Cart

If you are ready to order, navigate to Shopping Cart and get ready to checkout.

Looking for a specific manual?
Request a Manual

Request more Information

Please complete the form below and a representative will contact you as soon as possible.

Request a Manual

Please complete the form below and a representative will contact you as soon as possible.

Request a Quote

Please complete the form below and a representative will contact you as soon as possible.